KEGG   Meleagris gallopavo (turkey): 100546550
Entry
100546550         CDS       T01523                                 

Gene name
PRKDC
Definition
(RefSeq) LOW QUALITY PROTEIN: DNA-dependent protein kinase catalytic subunit
  KO
K06642  DNA-dependent protein kinase catalytic subunit [EC:2.7.11.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03450  Non-homologous end-joining
mgp04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    100546550 (PRKDC)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100546550 (PRKDC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mgp01001]
    100546550 (PRKDC)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mgp03032]
    100546550 (PRKDC)
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100546550 (PRKDC)
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100546550 (PRKDC)
Protein kinases [BR:mgp01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   100546550 (PRKDC)
DNA replication proteins [BR:mgp03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other termination factors
    100546550 (PRKDC)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA-PK complex
     100546550 (PRKDC)
SSDB
Motif
Pfam: DNAPKcs_CC5 NUC194 DUF1661
Other DBs
NCBI-GeneID: 100546550
NCBI-ProteinID: XP_010707207
Ensembl: ENSMGAG00000010711
LinkDB
Position
3
AA seq 2845 aa
MCRATFPCYIQFPFVRQLQSSHWRDTLHVSLVFAPERGLLAFVCRSLGVEEFRECREEAL
KFLCVFLEKIGERVHPYACSLKQTCISVYTKERAAKCKIPALELLIKLLQSLRRSCLMEE
MKVGEIFNKFYGELAVRSRVSDTVLEKIYELLGVLGEVHPTDMINNSEKLFRAYLGELKT
QMTSATRVPKLPVVAGCLRGLTALMYNFTKSMDEDAQTSKEIFDFAVKAIRPQVDQKRYA
VHLAGLQLFSWHAAQFGTLLLDSYVMLFETMCRWCGHTNQELKKAGHNALDSFLKQMSLM
VAKDAELHRSKLKFFMEQFYGIIRRMDSSNKELSIAIRGYGLFAAPCKAIHPADVDAMYV
ELLQRCKQMYLTEAETMDDHLYQLPSFLQSIASVIFHLDAIPEVYTPVLEHLVVLQINSF
PQYSEKMQLVCCRSIIKVFLALSIKGPVLWSFIGTVVHQGLIRVFSKPMTFSKDVFRKET
SGSEDFPEAGEVETAKWKVPTYKDYLYLFRSLLSCDTMKESIFEEENFLTGNSPLQSLNR
LLYDELIKSILKIIEKLDLTVQKLNVHEQDESETDNAFIGPTSDPASNLQPKKPTDFIAF
INLVEFCRDILPDKHVEYFQPWVYSFGYELIVHSTRLPVISGFYNLLSVTMKIAKKIKYF
EGVSPRSLRKATEDPEKNSCFALFAKFGKEVTAKMKQYKDELLASCLNFLLSLPHDIIML
DIKAYIPALQNAFKLGLSCTPMADLGLDALEDWSAHIPRHIMQPYYKDVLPLLDGYLKNS
ATAVEPQNNWEVRKLSRAAQKGFNKIVIQRLRKAKTSSLDDSPSLEGVRTRVARLLGSLG
GQINHNLITATSAEEMMKKCVSWDTENHLSFAVPFADMKPVIYLDVFLPRVTDLALSASD
RQTKVAACELLHSIVAYMLGKASQMPERQQGSPPMYQLYKRIFPVLLRLACDVDQVTRQL
YEPLVMQLIHWFTNNKKFESQDTVTFLEAILSGIVDPVDSTLRDFCGQCVREFLKWSIKQ
TTPRQQEKSPANTKSLFKRLYSLALHPSAFKRLGAALAFNSIYREFREENSLVEQFVFEA
LVVFLESLALTHTDEKSLGTTQQCCDAINHLKRIIKHKAPALNKEGKRRVPRGFPATKSV
CLQDVVMWLLVQCGRPQTECRHKAMELFYEFVPLLPGNNSPSSWLADVLKKKDVSFLINK
FEGGGSDAESPSGILSQPTLRNMQEPFSLPTVMRWMDMFLAALDCYNTFFELRMIKPHEI
LGVNDRSSFLEAVDFFLETIALHDIHAVERCFDCRLRGNIFSPQEREMYNYSKCTIIVRI
MEFVTMILETCQQDFWKLLEKELLNANFVELLVMTVCDPSHIGFNTADVQVMKNLPDISV
RLLKALMKSPCKEYLQLCLRKRITPQSFEDLFSVDLFNSDERFDQVRFSAVLSACKQLQK
SGLLHSVLHNQGERPHPSIGSKLLSVVYKGIAPGSERSSLPAVDISSKRLADRLLQLAFA
IDDQCEELVSLLLNTVVLSVPLSEASERNFVNFSHGQYFYSLFSDTINQQLLKNLDVIVI
QLMESSVSNPQMVGSILNGMLDQSFRERTIRKQQGVKLVTAVLRNWKRLDSWWAKGSSPE
SKMAVLTLLAKVLQIDSSVSFNTSHEAFTAVFDTYTSLLTDQNLGLNLKGQAVIILPFFT
NLTGEKLNELKNALDQLVAFNFPMSSDEFPRGTLKHNNYVDCTKKFLDALELSQSPMLLQ
LMTEILCRDHRHSMEDLFQASFKRISRRSSTDKQVVLLDTVHKMFQNEDLLSNTVRQAFV
DRSLLTLMSHCSLDALREFFAXIIVQAMDTLNSRFTKSNECVFDTQITKKMGYYKLLEVM
YIRLSKEDVHSKDSKINQAYRGSVSVEGNELTKALIKLCYDAFTENMAGESQLLEKRRQY
HCAAYNCAIAVISCVFTESKFYQGFLFTEKSEKNLLIFENLIDLKRQYMFPVEIEVPLER
KKRYIAIRKEAREAWNDGQDEPKYLASASYMMDSSLSEEMSQFDFSTGVQGFSYSSQDVT
ASSAHFRRKEMSEYMVLNDELELEMDELNQHECMAPMTTLIKHMQRNQITPKVEEGVVPV
DLPLWMKFLHSKLGNPSVPLNIRLFIAKLIVNTEDVFRPYAKQWLGPMLQLVVSGNNGGE
GIHFMVVEIAVTVLSWTSVNTPKGNIKDEILANRLLEFLMKNAFHQKRAVFRHNLEIIKT
VIECWKNCLSIPYSLIFEKFSSEDPDTKDNSVGIQLLGIVLANNLPPYDLKCEIDRVRYF
QALISNMGLLRYKEVYAAAAEVLGLALQYIAERQNILEDPVYDCVIKQLKHHQNTQQDKF
IICLNKVVKNFPPLADRFMNAVFFLIPKLHGVMKNYCLEVIMYRAEEIPDLYLQLKSKDF
IQIMKHRDDERQRVCLDIIYKMLSTLKPPELKELLPGVTGFISHPSVICRQRMYDILMWI
YDNYSDPESQAGDDSQEVHGLAKETLLQGLIDENAELQLIVRNFWSDETRLPANILDRML
KLLSSLYSAKIETQYLSLITNFLLEMTSKSPDYSRKIFEHPLSECKFQDFVIDSSWRYRS
TILTPMFVETQASQSTNRNSSQEKSLSISGSVGGRVRATQRQYEFTPTQNVGGRSSFNWL
TGNSIDTLAEYTVPSSSESLSSSMLLVNKRSEKFKPVGPDFGXKRLSLPGDKVNSKTKGI
DERAEILRLRRRFLKDQEKVSLIYARKGVAEQKREKEMKSELKMKFDGQVTLYRNYRVGD
LPDIQIEHSSLIAPLQALAQKDPTFAKQLFSSLFAGIFHEVKKSKTLSEKKVIIQKLLKD
FNHFLSTSLSYFPPFIACIQVNLSL
NT seq 8538 nt   +upstreamnt  +downstreamnt
atgtgcagagcaacttttccttgttacatccaatttccttttgtgaggcagcttcagtct
tcacactggagagacacgctgcacgtctccctggtgttcgctccggagcgcggcctgctg
gcgttcgtctgccgctcgctcggcgtggaggagtttcgagaatgcagagaagaagcgttg
aagtttctctgcgtctttttggaaaagattggagagagagttcatccttacgcctgcagc
cttaagcaaacttgcattagtgtttatacaaaagagagggcagcaaaatgtaaaattcca
gctctggaacttctgattaagttgctccaaagcttacgacgttcctgtctgatggaagag
atgaaagttggggaaatctttaataaattctatggggagcttgctgtaagaagtagagtt
tctgatacagtactggagaagatctatgagcttttgggagttttgggagaagtccatcct
actgacatgattaacaactctgaaaaactattccgagcgtatttgggagagcttaaaaca
cagatgacatcagctacgagggtccccaagctacctgttgtagcaggatgcctgagggga
ctgactgcactcatgtacaactttaccaagtctatggatgaagatgctcaaacttcaaag
gagatttttgattttgcagtgaaagctatcaggccacaggttgatcagaagcgatatgca
gtacatctagctggtttacaattgttcagctggcatgctgctcagtttggtaccctgctc
ttggacagctatgtcatgctctttgaaacaatgtgtagatggtgtggccacacaaatcaa
gagctgaaaaaagctggtcataatgcactagattcattcctcaaacagatgtctctaatg
gtggcaaaggatgcagagctacacaggagcaaattgaagttcttcatggagcagttctat
gggatcatcagaagaatggattcgagcaacaaggagctgtccatagctattcgtggatat
gggctatttgcagcgccttgcaaagctatacatcctgcagatgttgatgccatgtacgtt
gagctccttcagcgctgtaagcaaatgtacctcacagaggcagagacaatggatgaccat
ctgtatcagcttccaagtttccttcagtccattgcaagcgtgatattccatttagacgcg
attccagaagtatacactccggttcttgagcatctagttgtgctacaaatcaatagcttt
ccacaatacagtgaaaaaatgcagttagtctgttgcagatcaataataaaggtgtttcta
gccctctcaataaaaggtcctgttctctggagttttattggcactgttgtgcatcaggga
ttaatcagagtattctccaagccaatgacgttttcaaaggatgttttcagaaaagaaact
tctggatcagaagacttcccagaagctggagaggttgagacagcaaaatggaaagtacca
acctataaggactatctgtatcttttcagaagcttactgagttgtgacacgatgaaggaa
tccatttttgaagaagaaaactttcttactggaaattcaccactgcagtctctgaatcgg
ttgctatatgatgaactcataaaatctattttgaagattattgagaagttggatctgact
gttcagaaactgaatgtccacgagcaggatgaaagtgaaaccgacaatgcttttattggg
cctacttctgaccctgcttcaaaccttcagccaaagaaacccacagactttattgccttt
ataaacttggtagaattctgcagagacatacttccagataaacatgttgaatactttcag
ccttgggtgtattccttcggttacgagcttattgtacattcaacgagactacctgttatc
agtggattctacaatctgctttctgttacaatgaagattgccaagaaaataaaatacttt
gagggtgtcagtccaaggagtctcagaaaagctactgaagaccctgaaaagaattcttgc
tttgccctgtttgcgaagtttggaaaagaggttacagcaaaaatgaaacagtataaagat
gagttgttggcatcctgtctaaattttttactctctttaccccatgacatcatcatgctt
gatatcaaagcatatattcctgcactgcagaatgcatttaagctgggccttagctgtaca
ccaatggctgatctgggactggatgctttggaagattggtcagctcacatccccaggcat
atcatgcaaccttattacaaggatgtgctacctcttcttgatggttatttgaaaaactct
gcaactgcagttgaaccccaaaataactgggaagtaaggaagctttcccgagcagcccag
aaaggatttaacaaaattgtgatacagcgtttaagaaaagcaaaaacttcttcattggat
gacagtccctccttagaaggagtaaggactagagtggctcgccttcttgggtctttagga
gggcagatcaaccacaacttaattacagccacctctgcagaagagatgatgaagaaatgt
gtgtcctgggacaccgagaaccacctgagctttgctgtgccatttgcagacatgaagcct
gtcatctacttggatgtgtttctgcctcgtgtgactgacctggctctttctgcaagtgac
aggcaaacaaaggttgcagcatgtgaactgctacatagcattgttgcatatatgctgggg
aaagcatctcagatgccagaaagacaacagggttcaccacccatgtatcagttatacaaa
cgaatatttccagtactacttcgtcttgcctgtgatgtagaccaggttacgagacagttg
tatgagcctttagtcatgcagctcattcactggtttacaaacaacaagaaatttgagagt
caagatacagtgacgtttctggaagccatcttgagtggcatagtggatccagttgacagc
actctgagagatttctgcggtcagtgtgtacgagaatttttgaagtggtctattaagcag
acaacaccgagacagcaggagaaaagcccagcaaacaccaagtctctttttaaaagatta
tatagtcttgctcttcatcccagtgctttcaagagactaggtgcagcacttgcttttaac
agcatctacagagaatttagggaagagaattctctggtggaacagtttgtatttgaagca
ttggtggtatttctggaaagtctggctttaacccacacagatgagaaatcattaggtacc
acccaacaatgttgtgatgctattaatcacctgaagcgcataatcaagcataaagcacct
gctctgaataaggaaggaaaacggcgggtaccacggggatttccagctactaagtcagtg
tgccttcaggatgttgtcatgtggctcttagtacagtgtggacgacctcagacggagtgt
cgacataaagccatggagctcttttatgaatttgttcctttattgccaggaaacaattct
ccatcttcttggctggctgatgttttaaaaaagaaagatgtttccttccttattaacaaa
tttgaaggaggtggcagtgatgccgaaagcccatctgggattctttctcagccaactctc
cgtaatatgcaggagccctttagtttaccgactgtcatgcggtggatggacatgttctta
gcagcactggactgctacaatactttctttgagctgcgaatgatcaagcctcatgaaata
ctgggtgtaaatgacaggtcctcattcttggaagcagtggatttcttccttgaaactatt
gccttgcatgatattcatgcagtggagcggtgctttgattgcagattgagaggcaacata
ttcagtcctcaagagagagaaatgtataattacagtaagtgtacaattatcgtgcgaatc
atggagtttgtcaccatgatcctggaaacatgccagcaggatttctggaagctacttgag
aaggaattgcttaatgcaaactttgtagagcttctggtgatgacagtgtgtgatccatca
catataggatttaatacagctgatgtacaagtcatgaaaaatctcccagatatctcagtg
agactcttgaaagctttgatgaaatctccctgtaaagaatatttgcaattatgtttaaga
aaaagaatcacaccgcagagctttgaggaccttttttctgttgatctgttcaattcagat
gagcgtttcgatcaagttaggtttagtgctgttctttctgcctgcaagcaactccagaaa
tctggtctacttcattctgttcttcacaatcagggtgaaaggcctcatccctcaattggc
tctaagcttctttcggttgtttataaaggcattgcacctgggagtgaaaggagctctctt
ccagcagtagacatcagcagtaagcgattagctgatagactcctgcagcttgcctttgcc
attgatgaccagtgtgaggagctagtaagtctgctgttgaacacggtggtgttatctgtg
ccattatccgaagcctcagagagaaactttgttaatttttctcatggacagtatttctac
agcctgttctcagacaccattaatcagcagctgctaaaaaatctggatgtgatagtaatc
cagcttatggaatcatctgtcagcaatccccagatggttggaagcattttgaatggcatg
ttagatcagagttttagggagcgtaccatacgcaagcagcaaggagtgaaactggtcaca
gcagtactgagaaactggaagaggcttgacagttggtgggccaaaggttcatctcctgag
agcaaaatggcagtcttgactctgctggcaaaagttctccagatagactcttcagtttct
ttcaataccagtcatgaagcatttacagctgtttttgatacctataccagtctacttact
gatcagaatttaggcttaaatctgaaaggccaggcagtgataattcttccattcttcact
aatttgactggagaaaaacttaatgaacttaagaatgctcttgatcaacttgtagctttc
aattttcctatgagttcagatgagtttcccagaggaaccttgaagcacaataactatgtg
gactgcactaagaagtttttagatgctttagagttgtctcagagtccaatgttgttgcag
ttgatgacagaaatcctctgtagggaccatagacattctatggaggacttatttcaagcc
agcttcaaaagaatttccagaaggagcagcactgacaaacaagtggtactgctggacact
gttcacaagatgttccagaatgaagaccttctttcaaatactgtccgtcaagcttttgtg
gatcgctctctcctcactctcatgtcacactgcagcttggatgctttgagagagtttttt
gcanagattatagtgcaggctatggatacacttaattccaggtttacaaagtccaatgaa
tgtgtttttgatacacaaatcaccaagaaaatgggttattacaagctgctggaagtgatg
tatatacgtctttcaaaagaggatgttcactccaaggactctaaaattaaccaagcttac
cgtggctctgtaagtgtagaaggaaatgaacttaccaaggcactaataaagttgtgctat
gatgcatttacagaaaacatggcaggggagagtcaactgctggagaagaggagacagtat
cactgtgcagcatataattgtgctattgctgttattagttgtgtcttcactgaaagtaaa
ttttatcaaggctttctctttacagaaaaatcagaaaagaacttgctgatttttgaaaac
ttgatagacttgaagcgtcagtacatgtttcctgtagaaattgaggttcccctggaaagg
aagaaaagatacattgctattagaaaagaagccagagaggcatggaatgatggtcaggat
gaacccaagtatttagcttctgcatcatacatgatggatagcagtttgagtgaggaaatg
agtcagtttgatttttctactggagtccaaggtttttcttatagctcccaggatgttaca
gctagcagtgctcacttcaggagaaaggagatgtcagaatacatggttttaaatgatgag
ttggaactggagatggatgaacttaaccaacatgagtgtatggcaccaatgaccactctg
attaagcatatgcagaggaaccagatcacacccaaagtggaagagggcgtggttcctgta
gacctccctctttggatgaaatttctgcatagtaagttaggaaatccgtcagtgccatta
aatattcgcctcttcatagcaaaacttattgttaatactgaggatgttttccgaccctat
gcaaagcagtggcttggtccgatgctgcagcttgttgtttctggcaataatggaggtgaa
gggattcattttatggtagtggaaatagcagttaccgttctttcctggacgagtgtaaat
actcccaaaggaaatattaaggatgagattttggctaacagattgcttgaattcttaatg
aagaatgcctttcatcagaaacgagctgtgttcagacacaacctggaaatcataaagaca
gttatagagtgttggaagaactgtctctccataccttacagcttaatatttgaaaagttt
tctagtgaagatcctgatacaaaggacaactcagtgggaattcagctgctgggaattgtt
ctggctaacaatttacctccctatgacctgaagtgtgaaatagatcgtgtcaggtatttt
caggctctgatcagtaacatgggtttattaaggtataaagaagtttatgcagctgcagca
gaagtgttgggacttgctcttcagtatatagctgagagacaaaatatacttgaagatcca
gtttatgattgtgtcataaaacaattaaaacatcatcagaacactcaacaggataagttt
ataatatgcttgaataaagttgttaagaattttcctcctcttgctgacaggtttatgaat
gcagtattctttttaataccaaaacttcacggtgtgatgaaaaactactgtctggaagta
attatgtaccgagcagaggaaatacctgatctctatctgcagttaaagagtaaagacttc
atccagatcatgaaacacagggatgatgaaaggcaaagggtttgtttggatataatatac
aagatgctgtctacactgaaaccaccagaacttaaagaacttcttcctggagtgacaggg
ttcatttctcacccttctgtaatatgtcgacagcgcatgtatgatattctgatgtggatt
tatgataattacagtgatccagaaagccaagcaggtgatgattctcaggaagtgcatgga
ctggcaaaagaaaccctgcttcagggtctgattgatgagaatgctgaactgcaattaatt
gttaggaatttttggagtgacgagacaagattacctgcaaatattcttgatcgtatgctg
aagttgttaagttctttatattctgccaagattgaaacacagtacttgagtctgatcaca
aattttctgcttgaaatgaccagcaaaagcccagattattccaggaaaatatttgagcac
ccactatctgaatgcaaatttcaggactttgtaattgattccagttggcgttatcgaagt
accattctcacacctatgtttgtggagactcaggcttcacagagtactaacaggaattca
tcacaagaaaaatccctttccatttctgggtcagtaggtggtcgagtgagagctacccaa
aggcaatatgaatttacacctacgcaaaatgttggtggtagaagttcttttaattggcta
actggaaacagcattgacactttggcggagtatacagttccttcttcctctgagtctttg
tcttcatccatgctgttagttaacaaacggagtgaaaaatttaaacctgtggggccagat
tttgggnaaaaaaggctgagtttacctggagataaagtgaacagcaaaactaaaggtata
gatgaacgagcagaaattttaagactgcggaggcgtttcttgaaggaccaagagaaagtc
agtctgatttatgctagaaaaggtgtggctgaacagaaaagagaaaaggagatgaaatct
gagctgaagatgaagtttgatggccaggttactttgtacagaaattaccgtgtaggagac
cttcctgacatccagattgaacactccagcctcattgcccctctacaggcccttgcccag
aaagatccaacatttgccaagcaacttttcagcagtttgtttgctggaatttttcatgag
gtgaaaaaatctaaaactctttctgagaaaaaagtcatcatccagaagctgctgaaggac
ttcaatcatttccttagtacaagcctttcttacttcccaccattcattgcgtgcatccag
gtaaatcttagtctgtga

DBGET integrated database retrieval system