KEGG   Meleagris gallopavo (turkey): 100547634
Entry
100547634         CDS       T01523                                 

Symbol
MLH1
Name
(RefSeq) DNA mismatch repair protein Mlh1
  KO
K08734  DNA mismatch repair protein MLH1
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03430  Mismatch repair
mgp03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    100547634 (MLH1)
   03460 Fanconi anemia pathway
    100547634 (MLH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100547634 (MLH1)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutL homologs
     100547634 (MLH1)
SSDB
Motif
Pfam: Mlh1_C DNA_mis_repair HATPase_c_3 HATPase_c
Other DBs
NCBI-GeneID: 100547634
NCBI-ProteinID: XP_010711319
LinkDB
Position
6
AA seq 765 aa
MALVAGVIRRLDEAVVNRIAAGEVIQRPANAIKEMIENCLDAKSTSIQVVVKEGGLKLIQ
VQDNGCGIRKEDLHIVCERFTTSKLQKFEDLASISTYGFRGEALASISHVAHVTVTTKTA
DAKCAYRASYSDGKIKAPPKPCAGNQGTQIMVEDLFYNVNTRRKALKNPSEEYAKILEVV
GRYAIHNSGISFSVKKQGDTVSDVRTLANATTVDNIRSIFGNAVSRELIEVGCEDANLAF
KMKGYITNANYSVKKCIFLLFINHRLVESTALRKAIETVYAAYLPKSTHPFLYLSLEIAP
KNVDVNVHPTKHEVHFLHEDSILERVQQHVESKLLGSNSSRMYFTQTLLPGAECSSSEVV
KSATSSSTATKGTSDKVYAHQMVRTDSREQKLDAFLQPVNNPMSTGPTEETTGVNVGPLE
SASGGQQGRPVRPQDAEMEDVSELLETADLIEMADVQQDAVMPGGLSKSGHLSPEKALPR
KRPREDTDIQMEEDTRKEMTAACTPKRRIINLTSVLTLQEEISSQAHESLQEMLRDHSFV
GCVSPQWALVQHRTKLYLLNTTKLSQELFYQILIYDFANFGVLRLSEPAPLYELAMLALE
DPESGWTEEDGPKEGLAEYIVEFLKKKTEMLKDYFSLEIDEEGNLTGLPLLIDNYIPLLE
GLPMFVLRLATEVNWDEEKECFESLSKELSMFYSIRKQYIIDETNLTSSQNEDSDSGSPP
WKWTVEHVVYKAFRTHLLPPKHFTDDGNILQLANLPDLYKVFERC
NT seq 2298 nt   +upstreamnt  +downstreamnt
atggctttggtagctggcgtcatccggcggctggatgaggccgtggtgaaccgcatcgcg
gccggcgaggtcatccagagaccggcaaacgccattaaggagatgatagagaactgtttg
gatgctaaatctacaagtatccaggtggtagtcaaagaaggtggtctgaagctcatccag
gtccaagataacggctgtggtatcagaaaggaagatctgcatattgtttgtgagagattt
actaccagtaaactacagaaatttgaagacttggctagtatttcaacgtatggttttagg
ggtgaggcattggctagcatcagtcatgttgcccatgttacagtaacaactaaaacagct
gatgcaaagtgtgcatacagagcctcttacagtgatggaaaaatcaaagcccctccaaaa
ccctgtgctggaaaccaagggacacaaatcatggttgaagatcttttttacaatgtaaat
acaaggaggaaagctttaaaaaatccgagtgaagagtatgcaaaaatactagaagttgtt
ggcaggtatgccatccataactcaggtatcagcttttcagttaaaaagcaaggtgatact
gtgtcagatgttagaactttagcaaatgctacgacggtggacaacattaggtccatcttt
ggaaatgctgttagcagggaactcatagaagtgggctgtgaagatgcaaatctggccttt
aaaatgaaaggctacatcacgaatgccaactactctgtgaagaaatgtatatttttactc
ttcataaaccatcggctggtagagtcaactgctttgcggaaagccatagagactgtgtat
gctgcttatttgccaaaaagtactcatccattcctatacttaagcctggaaatagcccct
aaaaatgtagatgtgaatgtgcaccctacaaaacatgaggtccacttccttcatgaagac
agcattctagagcgtgtgcaacaacacgtagagagcaagctgctgggttctaattcttca
aggatgtacttcactcagacattgcttccaggggccgaatgttcttccagtgaggtggta
aaatcagcaacaagctcttctacggctacaaaaggaaccagtgataaagtttacgcgcac
caaatggtccgcactgattcccgagagcagaagttggatgcttttcttcagccagtgaac
aaccccatgagtacaggccccaccgaagagacaacaggggttaacgtgggacctctggag
agcgcgtcaggaggccaacagggccgtcctgttaggccgcaggatgctgaaatggaagat
gtgagtgagcttcttgaaacagctgatctaattgaaatggctgacgttcagcaggatgca
gtgatgcctggagggctgagtaagagcggacacttgtctcctgagaaagcactccctcga
aagagaccacgggaagacacagacatacaaatggaagaagacaccaggaaggaaatgact
gctgcctgcacccctaaaagaagaattatcaatttgaccagcgtgttgacacttcaggag
gaaattagcagccaggcacatgaaagtcttcaggagatgctgcgtgatcactcatttgtt
ggctgtgtcagccctcagtgggctctggtgcagcatcggacaaaactgtatcttctcaac
acaacaaaactcagccaggaactcttctaccagatacttatttatgactttgcaaacttt
ggcgttctaagactctctgagccagctcctttatatgagcttgcaatgcttgctttagag
gacccagagagtggctggacagaagaagatggcccaaaagaaggccttgctgagtacata
gttgagtttctgaaaaagaagactgaaatgttgaaagactatttctctcttgaaattgat
gaggaaggaaaccttactggattaccacttctgatagacaactacattcccctgctggag
ggactaccaatgtttgtccttcgtttggcaactgaggtaaactgggatgaagagaaggag
tgctttgaaagcctaagtaaagaactgtctatgttctactccattagaaaacaatatata
atagatgaaaccaacctgacaagctctcagaatgaggattctgactctggttcaccacca
tggaaatggacagtggagcatgttgtttacaaagccttcaggactcatcttttacctcct
aaacacttcacagatgatggcaacattttgcagcttgctaacctgcctgacttgtataaa
gtttttgagagatgctaa

DBGET integrated database retrieval system