KEGG   Meleagris gallopavo (turkey): 100547823
Entry
100547823         CDS       T01523                                 

Gene name
MRE11
Definition
(RefSeq) double-strand break repair protein MRE11 isoform X1
  KO
K10865  double-strand break repair protein MRE11
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03440  Homologous recombination
mgp03450  Non-homologous end-joining
mgp04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    100547823 (MRE11)
   03450 Non-homologous end-joining
    100547823 (MRE11)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100547823 (MRE11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mgp03032]
    100547823 (MRE11)
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100547823 (MRE11)
DNA replication proteins [BR:mgp03032]
 Eukaryotic type
  DNA Replication Termination Factors
   MRN complex
    100547823 (MRE11)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    MRN(MRX) complex
     100547823 (MRE11)
    BRCA1-C complex
     100547823 (MRE11)
   NHEJ (non-homologous end-joining)
    MRX complex
     100547823 (MRE11)
SSDB
Motif
Pfam: Mre11_DNA_bind Metallophos Metallophos_2 DUF1676
Other DBs
NCBI-GeneID: 100547823
NCBI-ProteinID: XP_010704409
Ensembl: ENSMGAG00000015197
LinkDB
Position
1
AA seq 674 aa
MSAVGLQDDEDTFKILIATDIHLGYLEKDPVRGNDTFVTFNEILEHAQKNEVDFVLLGGD
LFHENKPSRKTIHTCLESLRKYCMGDRPVQFEVLSDQAVNFQFSKFPWVNYQDENLNISM
PIFSIHGNHDDPTGVDALCALDILSCAGLLNHFGRSTSVEKIDISPILLRKGRTKIALYG
LGAIPDERLYRMFVNKQVTMLRPKEDEDSWFNLFVIHQNRSKHGATNYIPEQFLDDFINL
VVWGHEHECKITPAQNEQQHFYVTQPGSSVVTSLSPGEAVKKHVGLLRVKGKKMKMQRIA
LETVRTFYMEDVVLADHPELFNPDNPKVIQAIQAFCMEKVEMMLDNAERERLGNPRQPEK
PLIRLRVDYTGGFEPFIIHRFSQKFMDRVANPKDIIHFFRHREQKEKNDNDLNFGKLFSR
PASEGVTLRVEDLVKQYFQTAEKKVQLSLLTERGMGEAVQEFVDKEEKDAIEELVKFQLE
KTQRFLKERHIDAEEVKIDEEVRKFRESRRENTEEEDEEVREAMTRARAQRSKDVVLDSA
SSDEELMDTGMKASGDSDDDIPTTLSRGRGRGRARGARGQNSTARGSSRRGRAFRSLKPE
PSQSASKFFSEDIIDDELDLEESHINLSSKTNQRFSAMSSFSKRGSQSQTSRGVDFESDE
DDPFKNTATSRRKK
NT seq 2025 nt   +upstreamnt  +downstreamnt
atgagtgccgtcggcttgcaggatgatgaagatacttttaagatactgattgctactgat
attcatcttggctatttggagaaagacccagtgcgtggaaatgacacgtttgtaactttt
aatgaaattttggagcatgctcaaaaaaatgaagtggactttgttttattaggtggggac
ctctttcatgaaaacaaaccttccagaaaaacaatacatacttgtttagagtcactaaga
aaatactgcatgggtgatcgtcctgttcagtttgaagttctgagtgatcaggcagttaat
tttcagttcagcaagtttccatgggtgaactaccaggatgaaaatctcaacatttctatg
ccaatttttagtattcatggcaatcatgatgatcccacaggggtggatgcactgtgtgca
ctggatattttaagctgtgcaggattgctgaatcattttggacgttcaacttccgtggag
aaaatagatattagccccattttattacgtaagggtagaacaaaaattgctctgtatggc
ttaggggccattccagatgagaggttgtatcgtatgtttgtcaataaacaagtaaccatg
ctgagaccaaaggaggatgaagacagttggtttaacttgtttgtgattcatcagaataga
agcaaacatggagccacaaactacattccagagcagttcttagatgactttattaatctt
gttgtgtggggtcatgaacatgagtgtaaaataactccagcccaaaacgaacagcagcat
ttctatgttactcagccaggaagttcagtggtgacgtctctgtctccaggagaagccgta
aagaagcatgttggtttgctgcgtgttaaaggaaaaaaaatgaaaatgcagaggattgct
ttagagaccgtacgaactttctatatggaagatgttgtcctggctgatcacccagaactg
tttaatcctgacaatcctaaagtaattcaggcaatacaagcattctgcatggaaaaggtt
gaaatgatgctggataatgcagaaagagaacgccttggaaatccacgccagccagagaag
cctctcattagattacgagttgattacacgggtggctttgagccattcatcatccatcgt
ttcagccagaagttcatggatagggtggccaacccaaaggacatcatacattttttcaga
catcgtgaacaaaaagagaaaaacgacaatgatcttaattttggaaagctgtttagcaga
cctgcttctgagggggtgacactgagagtggaagaccttgtaaagcagtattttcagaca
gcagagaagaaagtacaactttcacttctaactgaaagaggaatgggagaagcagtgcag
gagtttgtggacaaagaagaaaaagatgccatagaggaactggtgaagtttcagctagag
aaaacacaaagatttcttaaggagcgtcacattgatgcggaggaagtaaaaatagatgag
gaggtgcgaaaatttcgggagagtagaagagaaaacactgaagaggaggatgaggaagtt
cgagaggcaatgacgagggctagagctcaaaggtccaaggatgtggttctagactcagcc
tccagtgatgaagaactcatggatacagggatgaaagcctctggtgattcagatgatgac
attcccacaacactgagccgaggaaggggtagaggaagggcaagaggtgcaagagggcaa
aattcaacagcaagagggtcatctcgaaggggaagagcctttaggtctttgaaaccagag
ccttcccagagtgcatctaaatttttctctgaggatattatagatgatgaattggatcta
gaagagtctcatattaatctttcctccaaaacaaaccaaaggttctcagctatgtcttca
tttagtaaaagaggttcacaaagccaaacatccagaggagttgattttgagtcagatgag
gatgacccgttcaaaaacactgcaacatcacgaagaaagaaatga

DBGET integrated database retrieval system