KEGG   Meleagris gallopavo (turkey): 100550168
Entry
100550168         CDS       T01523                                 

Gene name
DCLRE1C
Definition
(RefSeq) protein artemis
  KO
K10887  DNA cross-link repair 1C protein [EC:3.1.-.-]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    100550168 (DCLRE1C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100550168 (DCLRE1C)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     100550168 (DCLRE1C)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Other NHEJ factors
     100550168 (DCLRE1C)
SSDB
Motif
Pfam: DRMBL Lactamase_B_2 Lactamase_B RMMBL DHquinase_I
Other DBs
NCBI-GeneID: 100550168
NCBI-ProteinID: XP_003201898
Ensembl: ENSMGAG00000005053
UniProt: G3UPF1
LinkDB
Position
1
AA seq 714 aa
MSRFGGRLREYPQLSIDRFDHDNLRARAYFLSHCHKDHMKGLRAPALRRRLQSSLKVKLY
CSPVTKELLLTNSKYEFWENHIVALEVETPTQISLVDETTGEKEDIEVTLLPAGHCPGSV
MFLFQGENGTVLYTGDFRLAKGEAARMELLHSGTRVKDIQSVYLDTTFCDPRFYHIPSRE
ECLNGILELVRSWTSLSRYHVVWLNCKAAYGYEYLFINLSEELGIKVHVNRLDMFKNMPE
ILYHITTDRYTQIHACRHPKDDDYFRGNRLPCGITCQNGTPLHVISIKPSTMWFGERIKK
TNVIVRTGESTYRACFSFHSSYSEIKDFLSYICPVNVYPNVLPVGGSEDKVMEILQPLCR
SYRRNTEPRYKPLGTLKRACKRNLSDTDEDELFDTEPTFARPKIAKYQGEESKPSKTAQS
ENAEGNINESTESYRANTTYTSLKVDFVDCEESNDDDDDDDDDKEDDSEKNTAQVLSHEP
DANSLASCNGISSKQQESNADIPRWDMFFKCNKVDESSENEDNFPSSADAGGSQSLFSDS
DGVSDSTHISSQNSSQSTHISEQGSQGWDSQIDTVLIASQERNAADFGYFSRCGSRTALP
SHETPMDGQADNNRWKPLGQNPSCASDVICDLKIEDCDEDAEAGTASAQDLLVEISDSSR
TPDLELKRDFQSSSDFEIPLTPEAEIPQRDKLHYLYKKLAAGESIMRKNSPEKR
NT seq 2145 nt   +upstreamnt  +downstreamnt
atgagccggttcgggggccggctacgcgaataccctcagctgtccatcgaccgcttcgac
cacgacaacctgcgcgcacgcgcctatttcctgtcgcactgccacaaggatcacatgaag
gggctgagggcgcccgccctgaggaggaggctgcagagcagcttgaaagttaagttatat
tgctctccagtaactaaggaattactgttgactaactcaaaatatgagttttgggagaat
cacatagttgcactggaagttgaaactccaactcagatttctttagtagatgaaacaact
ggggagaaagaagatatagaggtgacactcctgccagctggccactgtccaggatcagtc
atgtttctgtttcaaggtgaaaatggcactgtgctgtatacaggggatttcaggcttgca
aaaggagaagcagccagaatggagcttttgcattcagggaccagagtaaaagacatccag
agtgtttatttggacaccactttttgtgatcctagattttatcatataccaagcagggag
gagtgtttgaatgggatcttagaattagtgcgaagctggacctcgctcagtcgctatcat
gttgtgtggctgaattgcaaagctgcttatggatatgagtatttattcataaacctcagt
gaggagcttggaatcaaggtgcacgtgaataggcttgatatgttcaaaaatatgccagaa
atcctctaccatataactacagaccgatacactcagattcatgcctgtcgacatcctaag
gatgatgactattttcgagggaacagactgccctgtggaatcacttgccaaaatggaact
cccttgcacgtaattagcatcaaaccctccactatgtggtttggagaaaggatcaagaaa
accaatgtaatagtgaggactggagagagtacctacagagcttgtttctctttccattct
tcatacagtgagattaaggattttttgagctacatctgtcctgtgaatgtgtatcccaac
gtattaccagtgggtgggtcggaagacaaagttatggaaatattacagccgttatgcaga
tcatacaggagaaacacagaacccaggtacaagcccctaggaacactgaagagagcctgc
aaaagaaacttatctgatacagatgaagatgagctctttgatacagaaccaacctttgca
aggcctaagattgcaaaatatcagggagaagaaagtaagccatccaaaactgcacagtct
gaaaatgctgaaggaaacataaatgagagcacagaaagctacagagcaaacacaacttat
acctctctcaaggtagacttcgtggactgtgaggagtcaaatgatgatgatgatgatgat
gatgatgacaaagaagatgattctgaaaaaaacacagctcaggttctttcccatgagcca
gatgccaattccttagcaagttgcaatggaatatctagcaagcaacaggagtctaatgct
gatatccctcgctgggatatgttttttaagtgtaacaaagtagatgaaagctctgaaaat
gaggacaacttcccatcttcagcagatgctggtgggtcccagtcactcttcagtgattcg
gatggagtgagtgactcaactcacatctcctcccaaaattcttctcagtcgacacacata
tcagaacaagggagccagggctgggatagccaaatagacacagttctcattgcctcccaa
gagagaaatgctgctgactttggctacttcagcagatgtggcagcagaacagctttgcca
tcgcacgagactcccatggacggccaagctgacaacaataggtggaaaccacttggccaa
aatccatcctgtgcttctgatgtcatctgtgacttgaaaattgaagactgtgatgaagat
gcagaagctggcactgcttcagctcaagatctgctagtggaaataagtgacagttccagg
actcctgatttagaactgaagagggactttcagagctcctctgactttgaaatcccctta
actccagaagctgaaatacctcaacgagataaactgcactacttatacaagaagctagca
gcaggtgaaagcataatgagaaaaaactctcctgaaaagaggtag

DBGET integrated database retrieval system