KEGG   Meleagris gallopavo (turkey): 104911759
Entry
104911759         CDS       T01523                                 

Definition
(RefSeq) non-homologous end-joining factor 1-like
  KO
K10980  non-homologous end-joining factor 1
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    104911759
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mgp03400]
    104911759
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     104911759
SSDB
Motif
Pfam: XLF
Other DBs
NCBI-GeneID: 104911759
NCBI-ProteinID: XP_019472914
LinkDB
Position
7
AA seq 146 aa
MTQRLFALLQMECSEELESRLLTQPWASVCFDESTFIAKACFGDTGYMLLISDLSGVWYE
SADTEAVGQRSKELNKRLTAHVSSVLQRLHGLLSPVLAGQPHAATSFSCQRPGGGLSLRV
RSELSGLPFYWDFRCRPAPVATVEAD
NT seq 438 nt   +upstreamnt  +downstreamnt
atgacgcagagactgtttgctctcttgcagatggagtgctccgaggagctggagagcagg
ctcctgacccagccttgggcttctgtttgctttgacgagtccacttttattgccaaagct
tgcttcggggatacaggctacatgctgctgatctccgacctcagcggtgtctggtacgag
agtgccgacacggaggctgtggggcaaaggtccaaggagctgaacaagcggctgacggcc
cacgtctcctcggtcttgcagcgcctgcacggcctcctgagccccgtgctggcagggcag
ccgcacgccgccacctccttctcctgccagcgcccgggcggcgggctcagcctgcgcgtg
aggagcgagctctcggggctgcccttctactgggacttccgctgccgccccgctcccgtg
gcgacggttgaggcggac

DBGET integrated database retrieval system