KEGG   Meleagris gallopavo (turkey): 104915276
Entry
104915276         CDS       T01523                                 

Gene name
XRCC4
Definition
(RefSeq) DNA repair protein XRCC4 isoform X1
  KO
K10886  DNA-repair protein XRCC4
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    104915276 (XRCC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mgp03400]
    104915276 (XRCC4)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     104915276 (XRCC4)
SSDB
Motif
Pfam: XRCC4 ParD_antitoxin XLF Leu_zip Pox_A_type_inc
Other DBs
NCBI-GeneID: 104915276
NCBI-ProteinID: XP_010724385
LinkDB
Position
Z
AA seq 334 aa
MEKTLIRIHPVSDPEAVYFLQVSWEKNISSGFGIILTDGERAWTGTVSEADISREAADME
MNREKYVEELKKALILGEESAGKYNFTVSVDEENTQCHFSYERNLKDGSFRLGSLKLQKV
SHPADVVKELIGYCLDCLGGLQVKNEHLQKENERLFCDLSDVEKRLEKCVEAKEELEADL
YNRFVLVLNEKKTKIRSLQKLLNEAKESAVDTQCTRDGIATTQMATEKEDDYDGSTEEES
ENLIQSSLPSAPERRDSLLGSPDVISTAPRRKRRQRTINPTGTEAKIATYETEKLAKEKL
DLSSQKTAGKHSPDVMSLETLENTCEPEDLFDDI
NT seq 1005 nt   +upstreamnt  +downstreamnt
atggagaaaactttgatcagaattcatccagtttctgatcccgaagcagtgtattttcta
caagtatcatgggaaaaaaatataagcagtggctttggtataatacttaccgatggtgaa
cgtgcatggactgggacagtgtctgaagctgatatttctagagaggctgctgacatggaa
atgaacagagaaaaatatgttgaagaactgaagaaagcgttgatacttggagaagaatca
gctggcaaatacaacttcactgtttcagtggatgaagaaaatacacagtgtcacttctcc
tatgaaagaaatctgaaagatggctcttttagacttggatctctgaagctacaaaaagtt
tcacatccagctgatgtggttaaagagctgattggctattgtctggactgcttaggagga
ctccaggtgaaaaatgagcacttgcaaaaagaaaatgagaggcttttctgtgatttgagt
gatgttgagaaaaggctggaaaaatgtgtagaagctaaagaagaactagaagcagatctt
tataatcggtttgttttggtgctgaatgaaaagaagacgaagataagaagcttgcagaaa
ttgttgaatgaagctaaagaatctgcagtggatacccagtgtacaagggatggtatagct
acaacacagatggcaacagagaaagaagatgactatgatggcagcactgaggaggaaagt
gaaaatttaatacagtcctcgttaccatcagcaccagaacgaagagattccctactgggt
agtcctgatgtcatcagtactgctccaagacgaaagagaagacaaagaacaataaatccc
actgggacagaagctaagatagcaacttatgagacagaaaagctagcaaaggaaaaactt
gatctctcctcacagaagacagcaggcaagcactccccggatgtgatgtctcttgaaaca
ctggaaaacacttgtgagccagaggatctctttgatgacatctag

DBGET integrated database retrieval system