KEGG   Meleagris gallopavo (turkey): 104915285
Entry
104915285         CDS       T01523                                 

Gene name
MSH3
Definition
(RefSeq) DNA mismatch repair protein Msh3
  KO
K08736  DNA mismatch repair protein MSH3
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    104915285 (MSH3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mgp03400]
    104915285 (MSH3)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     104915285 (MSH3)
SSDB
Motif
Pfam: MutS_V MutS_III MutS_I MutS_II MutS_IV
Other DBs
NCBI-GeneID: 104915285
NCBI-ProteinID: XP_010724412
LinkDB
Position
Z
AA seq 1022 aa
MDDICNPMKTQDKKDLLTYEKPRICLQTLDRLREFYCDSDQPCNRVQEDSFREKQSLILE
KCPNITGRSLELKNPLQYGDTSPKVAQKEEPHCDLSQFSASFRNYETTSDINLNKRTKTI
YTPLELQFIEMKKRYKDAILCVECGYKYRFFGEDAEIAAKELNICCHQDHNFMTASIPTH
RLFVHVRRLVAKGHKVGVIKQMETAALKAAGDSKSSLFSRKLTALYTKSTLIGEDVNPLL
KLDDSVDVEEVTTDVPDNYLLCICENGENAKNRKKGDILMGVMAIQPTTGEVVFDSFWDC
ASRLELESRFLRLQPVELILPSSLSDQSEKLINSVTSMSLTCIVAVGSFIINPSLEGPQK
LSVILSLDKPIICALAAVIAYLKEFNLEKMLYNPSNFKQLTSETEYMTINGTTMKNLEIL
QNQTDLKTKGSLLWVLDHTKTSFGRRRLKKWVTQPLMKSSEINARLDAVSEILLSESNVF
GQIQNLLCKLPDLERGLCSVFHKKCSTQEFFLIVSTLSRLDLEIQALVPAIHSHVKSPLL
QNALLEIPELLSPVKHYLKILNEEAAKTGDKTQLFKDLTDFPVIRNKKEEILDVLSKIQL
HLLEIREQIKNPSAEYVTVSGQEFLVEVKNSRISSVPSNWVMVSSTKAVSRFHSPFIIEN
YRHLNQLREQLVLDCGAEWLHFLDHFSEHYHPVSKAIGHLATIDCLFSLAQVAKQGDYCR
PVVKDNQQEIVIKNGRHPVIDVLLGEQDQYVPNTTNLSRDGERVMIITGPNMGGKSSYIK
QVALITVMAQIGSYVPAEESTIGVVDGIFTRMGAADNIYKGRSTFMEELTDTAEIIRKAT
SRSLVILDELGRGTSTHDGIAIAYATLEHFITDVESLTLFVTHYPSVCELEKVYPEKVGN
YHMAFLVNEEESAEQKGSEEEENPEFITFLYQITKGVTARSYGLNVAKLADIPEEILKKA
AHKSKELERLVNMKRKMLKSFAEVWKINDSQELEKWRNTSEPGDERTDFNPQIMLKDRKY
CR
NT seq 3069 nt   +upstreamnt  +downstreamnt
atggatgacatctgtaatccaatgaagactcaggataaaaaagaccttctgacgtatgaa
aagccccgcatatgtctgcaaactctagacagactgagagaattctactgtgattcagat
cagccatgtaacagagtccaagaagacagttttcgggagaaacaatcattgattttggag
aagtgccccaatattactgggagaagtctggaactgaagaaccctcttcagtatggggac
actagcccaaaggttgctcagaaggaggagccacactgtgatcttagccagttttctgca
tcctttagaaactatgaaactacttcagacataaatctcaataagagaaccaaaaccatt
tacactccactggaacttcaattcatagaaatgaagaaacgatataaagatgctattttg
tgtgtggagtgtggatacaaatatcgcttctttggagaagatgctgagattgcagctaaa
gagctaaacatttgctgtcatcaagatcataactttatgacagccagtataccaactcac
agactgttcgtccatgtgcgacgacttgtagcaaaaggacataaggttggagtaataaaa
caaatggaaactgcagcactgaaggctgctggagacagtaaaagctccctcttcagccgg
aaactgactgctctctatacaaagtctacacttattggagaagatgtgaaccctttgctg
aagttagatgattctgtagatgttgaagaggtaactacagatgtccctgataactacctc
ctctgtatttgtgaaaatggagaaaatgcaaaaaacagaaagaaaggtgacattcttatg
ggtgttatggcaatccaaccaactacaggagaagttgtttttgacagtttttgggattgt
gcatctcgcttagaattagagagtcggtttttacgcctgcagccagttgaactaatactt
ccatccagcttgtcagatcaatctgaaaagctcatcaacagtgtaacctccatgagttta
acttgcattgttgctgttggctcctttatcataaatcctagcttggaaggtcctcaaaaa
ctatctgtaatactaagcttggataagcctattatttgtgctctggcagcagtaattgca
tacctcaaagaatttaatttggaaaagatgctttacaatccaagcaatttcaaacagttg
acaagtgaaactgaatacatgacaattaacgggacaacaatgaaaaatcttgaaatttta
cagaatcagactgatttgaaaacaaaaggaagcctcctttgggtcttggatcatactaaa
acttcctttggtcgtcggagactgaagaaatgggtaactcaaccgctcatgaaatccagt
gaaataaatgcccggcttgatgctgtgtctgaaattctcctgtcagaatccaacgtgttt
ggccagattcagaatcttctttgtaagctgccagatttagagagaggtctctgcagtgtt
tttcacaaaaagtgttcaacccaagagttcttcttgattgtcagcactctgtctcgtctg
gacttggaaattcaagctcttgttccagccatacattctcatgtgaaatctcctctgtta
caaaatgcactgctggaaatcccagaacttctctccccagtaaaacattatttaaagatt
cttaatgaagaagctgctaagactggagataaaacccaactattcaaagaccttacagat
ttccctgtcatcagaaataaaaaggaagagattctggatgtgctgtctaaaatccaatta
catcttctggaaattcgtgaacaaattaagaatccttctgcagagtatgttacagtttct
ggtcaagagtttttggtagaagtaaaaaattcccgtatatcatctgtgccatctaactgg
gttatggttagtagcacaaaagctgtcagccgtttccactctccttttattatagaaaat
tacagacatctcaatcagcttcgggagcagctagtccttgactgtggtgctgaatggctg
cattttctagaccattttagtgagcattatcaccctgtatctaaagcgattggtcaccta
gcaactatcgactgtctgttctcattggcacaggtggctaaacaaggagactactgcaga
ccagttgtgaaagataatcagcaagaaatagttataaaaaatggcaggcaccctgtgatc
gatgtattactgggagaacaggatcaatatgttccaaacaccactaacctatcaagagat
ggtgaaagggtcatgataataactggacctaacatgggaggaaagagctcctatataaag
caagttgcattgatcacagtcatggcacagattggttcctatgttcctgcagaggagtca
acaattggcgttgtggatggtatttttaccagaatgggtgctgcagataacatttacaaa
ggccgaagtacctttatggaagaactgacagacactgctgagataataagaaaagcaact
tcaagatcactagtaattttggatgaactgggaagaggaactagcacgcatgatggaatt
gctattgcttatgccacacttgaacattttattacagatgtggagtcactaacgttgttt
gtcacccactatccttcagtttgtgagctagaaaaagtttatccagaaaaagttggtaat
taccatatggctttcttggtgaatgaggaagaaagtgctgaacagaaaggatctgaagag
gaagagaatcctgaatttatcacttttctttatcaaataactaaaggagtcactgcaaga
agctatgggctaaatgttgccaaactggcagatattcctgaagaaatcttgaagaaggca
gctcacaaatcaaaggagttagagagactggtgaatatgaaaagaaaaatgctgaagtct
tttgctgaagtatggaaaataaatgattctcaggaactagagaaatggagaaatacgtct
gaacctggagatgaaaggacagattttaatcctcagatcatgcttaaagatagaaaatac
tgcagatag

DBGET integrated database retrieval system