Pyricularia oryzae: MGG_06667 Help Entry MGG_06667         CDS       T01027                                  Name (RefSeq) hypothetical protein   KO K00730   dolichyl-diphosphooligosaccharide---protein glycosyltransferase subunit 4 Organism mgr  Pyricularia oryzae Pathway mgr00510   N-Glycan biosynthesis mgr00513   Various types of N-glycan biosynthesis mgr01100   Metabolic pathways mgr04141   Protein processing in endoplasmic reticulum Module mgr_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:mgr00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     MGG_06667    00513 Various types of N-glycan biosynthesis     MGG_06667  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     MGG_06667 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost4 Motif Other DBs NCBI-GeneID:  2684840 NCBI-ProteinID:  XP_003709372 UniProt:  G4MKS0 LinkDB All DBs Position 1:2324252..2324419 Genome browser AA seq 55 aa AA seqDB search MISDDELYKLAVFLGSAAMILIVIYHFVEVNTTDEAAEKAQRTPATAGKQAAALK NT seq 168 nt NT seq  +upstreamnt  +downstreamnt atgatctccgacgacgaactctacaagctggccgtatttctgggctcagcggccatgatt ctcatcgtcatataccattttgttgaggtcaacacaaccgatgaggcagcggagaaagca caaaggacaccggcgacggcaggcaagcaagcagcagcactgaagtga

DBGET integrated database retrieval system