Methylocystis heyeri: H2LOC_004375 Help Entry H2LOC_004375      CDS       T06290                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism mhey  Methylocystis heyeri Pathway mhey02024   Quorum sensing mhey03018   RNA degradation Brite KEGG Orthology (KO) [BR:mhey00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     H2LOC_004375 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     H2LOC_004375 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:mhey03019]     H2LOC_004375 (hfq)    03036 Chromosome and associated proteins [BR:mhey03036]     H2LOC_004375 (hfq) Messenger RNA biogenesis [BR:mhey03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      H2LOC_004375 (hfq) Chromosome and associated proteins [BR:mhey03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     H2LOC_004375 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 Motif Other DBs NCBI-ProteinID:  QGM44986 UniProt:  A0A6B8KA68 LinkDB All DBs Position 977965..978225 Genome browser AA seq 86 aa AA seqDB search MSERAQNLQDTFLNFVRKNKVPLTIFLVNGVKLQGIVTWFDNFCLLLRRDGHSQLVYKHA ISTIMPAHPIHMFEPGEDGEGAAEKR NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgtcggagcgcgcgcagaacctgcaagacacttttctgaattttgttaggaaaaacaaa gttcccctcacgattttcctcgtcaacggggtcaagcttcaaggaattgtcacctggttc gacaacttctgcctcctgcttcggcgggacggtcactcgcagctcgtctacaaacacgcc atctccaccataatgccggcgcacccgatccatatgttcgaacccggcgaagacggcgaa ggcgcggcggagaagcgttga

DBGET integrated database retrieval system