KEGG   Micromonospora sp. HM134: FJK98_15490
Entry
FJK98_15490       CDS       T06145                                 
Name
(GenBank) (2,3-dihydroxybenzoyl)adenylate synthase
  KO
K20423  2-hydroxy-7-methoxy-5-methyl-1-naphthoate---CoA ligase [EC:6.2.1.43]
Organism
mich  Micromonospora sp. HM134
Pathway
mich01059  Biosynthesis of enediyne antibiotics
mich01100  Metabolic pathways
mich01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mich00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01059 Biosynthesis of enediyne antibiotics
    FJK98_15490
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:mich01008]
    FJK98_15490
Enzymes [BR:mich01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.43  2-hydroxy-7-methoxy-5-methyl-1-naphthoate---CoA ligase
     FJK98_15490
Polyketide biosynthesis proteins [BR:mich01008]
 Polyketide tailoring proteins
  Others
   FJK98_15490
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-ProteinID: QDY08385
UniProt: A0A518WGL9
LinkDB
Position
complement(3647833..3649500)
AA seq 555 aa
MSAEATRPTLDGTVPWPPELVARYTDRGYWTHRPLGAYLYAAADADPARTCLVDGPVRLT
FAELTARADGAAERLRELGIRPDDRVVVQLPNCWEFVVLTVACFRLGAVPVMALPAHRRQ
EIAAIVALTGARALVVPDVLKDFDHQALAHEVAADAPTLRHVLVAGADVRADSVDLRRLC
RPADVPAAARSALDAAAPAGSAVALFLLSGGTTGVPKLIARTHDDYGYMMRRAAELSEVD
ASTVYLAVLPLAHGYPMAGPGILGTLLAGGRVVILPSPAPERAFEAVQRERATFTSLVPA
AVQRWLEYREKDPDRDLSSLRRVQVAGSRLADQVAQRVTPVLGCELQQVYGMAEGLLCLT
RPDDPQDVVCHSQGRPICPDDELRLVDEDGRPVPPGEPGVLLTRGPYTPRGYYRSPELTA
RAFTDGWYNTGDIVRLRPDGNLVIEGRDKDLINRGGEKISAEEVENFAYQLDAVSLAAAV
AMPDAELGERVCLYVVPQPGRTVALQDVRAVMQQAGVAAFKLPELLVTVDELPFTAVGKV
NKKQLRADVGRRLAG
NT seq 1668 nt   +upstreamnt  +downstreamnt
atgtccgcagaagcgacccgacctaccctcgacgggaccgtgccgtggccgccggagctg
gtggcgcggtacaccgaccggggctactggacccaccggccgctcggggcgtacctgtac
gccgccgccgacgccgaccccgccaggacgtgcctggtcgacggcccggtacgcctcacc
ttcgccgagctgaccgcccgcgccgacggcgccgccgagcgcctgcgggagctggggata
cgtcccgacgaccgggtggtggtgcagctgcccaactgctgggagttcgtcgtgctgacg
gtggcctgcttccggctgggcgcggtcccggtgatggcgctgccggcgcaccggcggcag
gagatcgccgcgatcgtggcgttgaccggggcacgggcgctggtcgtaccggacgtgttg
aaggacttcgaccaccaggcgctggcccacgaggtggccgccgacgcgccgaccctgcgg
cacgtgctggtcgccggggcggacgtccgcgcggacagtgtcgacctgcggcggctatgc
cggccggcggacgtcccggcggcggcccgctcggcgctcgacgccgccgcgcccgccggt
tcggcggtagccctgttcctgctctccggcggcaccaccggggtgccgaagctgatcgcc
cggacccacgacgactacggctacatgatgcgccgcgccgccgaactgtccgaggtggac
gcgtcgacggtctacctcgcggtgctgccgctggcgcacggatacccgatggccgggccg
ggcatcctgggcacgctgctggccggcggtcgggtggtgatcctgccgtcgcccgcgccg
gagcgggcgttcgaggcggtgcagcgggaacgggccaccttcacctcgctggtgcccgcc
gcggtgcaacgctggctggagtaccgggagaaggacccggaccgggacctcagctcgctg
cgccgggtccaggtcgccggctcccggctggccgaccaggtggcccagcgggtgacgccg
gtgctcggctgcgagctgcagcaggtgtacggcatggcggaggggctgctctgcctcacc
cgcccggacgacccacaggacgtggtgtgccacagccagggccggccgatctgccccgac
gacgagctgcggctggtcgacgaggacgggcggccggtgccgccgggcgagccgggggtg
ctgctgacccgggggccgtacacgccgcgcggctactaccggtcgccggagctgaccgcg
cgggcgttcaccgacggctggtacaacaccggggacatcgtccggctccggcccgacggg
aacctggtcatcgagggtcgggacaaggatctgatcaaccggggcggcgagaagatctcc
gccgaggaggtggagaacttcgcctaccagctcgacgcggtgagcctggccgccgcggtc
gccatgccggacgccgagctgggcgagcgggtctgcctctacgtggtgccgcagcccggc
cggacggtggccctgcaggacgtgcgggcggtgatgcagcaggccggggtcgccgcgttc
aagctgccggagctgctggtgaccgtcgacgagctgccgttcacggcggtcggcaaggtg
aacaagaagcagctccgcgcggacgtcggccgccggctcgccggctga

DBGET integrated database retrieval system