Micromonas commoda: MICPUN_79527 Help Entry MICPUN_79527      CDS       T02695                                  Name (RefSeq) predicted protein   KO K10845   TFIIH basal transcription factor complex TTD-A subunit Organism mis  Micromonas commoda Pathway mis03022   Basal transcription factors mis03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:mis00001]  09120 Genetic Information Processing   09121 Transcription    03022 Basal transcription factors     MICPUN_79527   09124 Replication and repair    03420 Nucleotide excision repair     MICPUN_79527  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:mis03021]     MICPUN_79527    03400 DNA repair and recombination proteins [BR:mis03400]     MICPUN_79527 Transcription machinery [BR:mis03021]  Eukaryotic type   RNA polymerase II system    Basal transcription factors     TFIIH      MICPUN_79527 DNA repair and recombination proteins [BR:mis03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TFIIH complex      MICPUN_79527 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tfb5 Motif Other DBs NCBI-GeneID:  8241990 NCBI-ProteinID:  XP_002500353 JGI:  MicpuN3_79527 UniProt:  C1E0T4 LinkDB All DBs Position 3:109990..110217 Genome browser AA seq 75 aa AA seqDB search MVSAVHGSLIETDIPCKVYILHINEQLPPAERFVIQDLDETHLLVQPHRLEYVKAEVKAW QQKNQFTPPTDLRQT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggtgtccgccgtgcacggctcgctgatagagaccgacatcccctgcaaggtttacatc ctccacatcaacgagcagctcccgcccgcggaacgtttcgtgatccaggacctcgacgag acccacctcctcgtgcagccccacaggctcgagtatgtcaaggcggaggtgaaggcgtgg cagcagaagaaccagttcaccccacccacggatctccgccagacgtga

DBGET integrated database retrieval system