Manis javanica (Malayan pangolin): 108383754 Help Entry 108383754         CDS       T06054                                  Name (RefSeq) C-C motif chemokine 3-like   KO K05408   C-C motif chemokine 3 Organism mjv  Manis javanica (Malayan pangolin) Pathway mjv04060   Cytokine-cytokine receptor interaction mjv04061   Viral protein interaction with cytokine and cytokine receptor mjv04062   Chemokine signaling pathway mjv04620   Toll-like receptor signaling pathway mjv05142   Chagas disease mjv05163   Human cytomegalovirus infection mjv05323   Rheumatoid arthritis mjv05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mjv00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     108383754    04061 Viral protein interaction with cytokine and cytokine receptor     108383754  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     108383754    04062 Chemokine signaling pathway     108383754  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     108383754   09174 Infectious disease: parasitic    05142 Chagas disease     108383754   09163 Immune disease    05323 Rheumatoid arthritis     108383754   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     108383754  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mjv04052]     108383754    00536 Glycosaminoglycan binding proteins [BR:mjv00536]     108383754 Cytokines and neuropeptides [BR:mjv04052]  Cytokines   Chemokines    108383754 Glycosaminoglycan binding proteins [BR:mjv00536]  Heparan sulfate / Heparin   Chemokines    108383754 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  108383754 NCBI-ProteinID:  XP_017495888 LinkDB All DBs Position Unknown AA seq 93 aa AA seqDB search MKVSGAVLATLLCTMALCSQVFSAPFGADTPTACCFSYISRQIPRKFIADYFETSSQCSK PGVIFTTKRGREVCADPSETWVQEYIADLEVNA NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctccggggctgtccttgccaccctgctgtgcaccatggccctctgcagccag gtcttctctgcaccatttggtgccgacaccccgaccgcctgctgcttctcctacatctcc cggcagattccacgcaaattcatagccgactattttgagaccagcagccagtgctccaag cctggtgtcatcttcacaaccaaaagaggccgggaggtttgtgccgaccccagtgagacc tgggtgcaggaatacatcgccgacctggaagtgaatgcctga

DBGET integrated database retrieval system