Manis javanica (Malayan pangolin): 108393727 Help Entry 108393727         CDS       T06054                                  Symbol PPP3R1 Name (RefSeq) calcineurin subunit B type 1   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism mjv  Manis javanica (Malayan pangolin) Pathway mjv04010   MAPK signaling pathway mjv04020   Calcium signaling pathway mjv04022   cGMP-PKG signaling pathway mjv04114   Oocyte meiosis mjv04218   Cellular senescence mjv04310   Wnt signaling pathway mjv04360   Axon guidance mjv04370   VEGF signaling pathway mjv04380   Osteoclast differentiation mjv04625   C-type lectin receptor signaling pathway mjv04650   Natural killer cell mediated cytotoxicity mjv04658   Th1 and Th2 cell differentiation mjv04659   Th17 cell differentiation mjv04660   T cell receptor signaling pathway mjv04662   B cell receptor signaling pathway mjv04720   Long-term potentiation mjv04724   Glutamatergic synapse mjv04921   Oxytocin signaling pathway mjv04922   Glucagon signaling pathway mjv04924   Renin secretion mjv05010   Alzheimer disease mjv05014   Amyotrophic lateral sclerosis mjv05020   Prion disease mjv05022   Pathways of neurodegeneration - multiple diseases mjv05031   Amphetamine addiction mjv05152   Tuberculosis mjv05163   Human cytomegalovirus infection mjv05166   Human T-cell leukemia virus 1 infection mjv05167   Kaposi sarcoma-associated herpesvirus infection mjv05170   Human immunodeficiency virus 1 infection mjv05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mjv05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mjv00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     108393727 (PPP3R1)    04310 Wnt signaling pathway     108393727 (PPP3R1)    04370 VEGF signaling pathway     108393727 (PPP3R1)    04020 Calcium signaling pathway     108393727 (PPP3R1)    04022 cGMP-PKG signaling pathway     108393727 (PPP3R1)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     108393727 (PPP3R1)    04218 Cellular senescence     108393727 (PPP3R1)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     108393727 (PPP3R1)    04650 Natural killer cell mediated cytotoxicity     108393727 (PPP3R1)    04660 T cell receptor signaling pathway     108393727 (PPP3R1)    04658 Th1 and Th2 cell differentiation     108393727 (PPP3R1)    04659 Th17 cell differentiation     108393727 (PPP3R1)    04662 B cell receptor signaling pathway     108393727 (PPP3R1)   09152 Endocrine system    04922 Glucagon signaling pathway     108393727 (PPP3R1)    04921 Oxytocin signaling pathway     108393727 (PPP3R1)    04924 Renin secretion     108393727 (PPP3R1)   09156 Nervous system    04724 Glutamatergic synapse     108393727 (PPP3R1)    04720 Long-term potentiation     108393727 (PPP3R1)   09158 Development and regeneration    04360 Axon guidance     108393727 (PPP3R1)    04380 Osteoclast differentiation     108393727 (PPP3R1)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     108393727 (PPP3R1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     108393727 (PPP3R1)    05170 Human immunodeficiency virus 1 infection     108393727 (PPP3R1)    05163 Human cytomegalovirus infection     108393727 (PPP3R1)    05167 Kaposi sarcoma-associated herpesvirus infection     108393727 (PPP3R1)   09171 Infectious disease: bacterial    05152 Tuberculosis     108393727 (PPP3R1)   09164 Neurodegenerative disease    05010 Alzheimer disease     108393727 (PPP3R1)    05014 Amyotrophic lateral sclerosis     108393727 (PPP3R1)    05020 Prion disease     108393727 (PPP3R1)    05022 Pathways of neurodegeneration - multiple diseases     108393727 (PPP3R1)   09165 Substance dependence    05031 Amphetamine addiction     108393727 (PPP3R1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     108393727 (PPP3R1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mjv01009]     108393727 (PPP3R1) Protein phosphatases and associated proteins [BR:mjv01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      108393727 (PPP3R1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_FSTL1 EH SPARC_Ca_bdg EF-hand_9 Motif Other DBs NCBI-GeneID:  108393727 NCBI-ProteinID:  XP_036878055 LinkDB All DBs Position Unknown AA seq 170 aa AA seqDB search MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgggaaatgaggcaagttatcctttggaaatgtgctcacactttgatgctgatgaaatt aaaaggctaggaaagagatttaaaaagcttgatttggacaattctggctctttgagtgtg gaagagttcatgtctctgcctgagttacagcagaatcctttagttcagcgagtaatagac atattcgacactgatgggaatggagaagtagactttaaagaattcattgagggagtctct cagttcagtgtcaaaggagataaggagcagaagttgaggtttgctttccgtatctatgac atggataaagatggctatatttccaatggggaactcttccaggtgctgaagatgatggtg gggaacaatctgaaagatacacagctacagcaaattgtagacaaaaccataataaatgca gataaagatggagatggaagaatatcctttgaagaattctgtgctgttgtaggtggccta gatatccacaaaaagatggtggtagatgtgtga

DBGET integrated database retrieval system