KEGG   Manis javanica (Malayan pangolin): 108401747
Entry
108401747         CDS       T06054                                 
Symbol
TNFRSF8
Name
(RefSeq) tumor necrosis factor receptor superfamily member 8
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108401747 (TNFRSF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mjv04050]
    108401747 (TNFRSF8)
   04090 CD molecules [BR:mjv04090]
    108401747 (TNFRSF8)
Cytokine receptors [BR:mjv04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   108401747 (TNFRSF8)
CD molecules [BR:mjv04090]
 Proteins
  108401747 (TNFRSF8)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 108401747
NCBI-ProteinID: XP_017523377
LinkDB
Position
Unknown
AA seq 588 aa
MRALRAVLGLSLLGALRAFPQDGARMDACARDPSRYYDEAARRCCYRCPEGLSAQQPCPQ
GSSDCQKQCEPDYYLGGSGGCLACVSCSKDDLVEKRPCSWNSSRVCECRAGMFCVTSATN
SCARCSLHSVCSAGMIVKFPGTAERDTVCESPSPGTSPDCSMSPEDCKAPASGTSPQAKP
SLTSLASNARTMLLGKGAPLLPEDDAEMTKTPNSSSSAGKLSSDPGLTLHQPCPQGSADC
QKQCEPDYYLERDGRCTACVSCSEECRPGMFCVTSATNSCARCVILPIYSPGTVTKLQGP
AERDSTYELPPPEAHSDCSTSPEDSEAPTSTSPFLTSPAGSQTSQGHGGGITHAWGDTIL
TSAPISFSSTGKPILGSGPVLFWVLVALMTVIGSISFLLCHRRACKKWIRQKLHLCYPVQ
TFQPKLEPADSRSGKSLTQSKRSASVAELSTGELGLMGAPAVKTCPSVGAACLESLQLLD
ASPAESPGPSRNPPEPRVATEQTNNRIEKIYIMKADTVIVGTVKTEVPEGRSLVGPAGPE
FEEDLEVDHAPHYPEQETEPPLGSCRDVMFSVEEEGKEGPLPTTVSGK
NT seq 1767 nt   +upstreamnt  +downstreamnt
atgcgcgccctccgcgctgtgctgggactgtccctcctcggagcgctccgagccttcccg
caggatggagcccgcatggacgcctgtgccagagaccccagccgctactatgatgaggca
gccaggaggtgctgttaccgttgcccagagggactgtctgcccagcagccatgcccacaa
gggtcctccgactgccagaagcagtgtgagcctgactactacctgggtgggagcggtggc
tgcctggcctgtgtgagctgttccaaagatgacctagtggagaagaggccctgctcatgg
aactcctcccgcgtctgtgagtgccgggccggcatgttctgtgtcacatccgccaccaac
tcctgtgcccgctgctccctgcattccgtctgctcagcagggatgattgtcaagttccca
ggcacagcagagagggacactgtctgcgagtcaccttctccagggaccagccctgactgc
agcatgagtccagaggactgcaaggcgcctgccagtggcaccagcccccaggccaagccc
agtttgacctccttagcaagcaatgccaggaccatgcttctcggaaagggtgctcccctc
ctcccagaagacgatgcagaaatgacgaagacccccaactcgtcctcctccgcggggaag
ctcagttcagatccagggctaaccctgcatcagccttgcccccaggggtctgctgactgc
cagaagcagtgtgagcctgactactacctggagagggatggccgctgcacagcctgtgtg
agctgttcggaagaatgtcgacctggcatgttctgtgtcacatcagccaccaactcctgt
gcccgctgcgtcattctccccatctactcaccagggacagtcaccaaactccagggtccg
gctgagagggacagtacctatgagctgcctcccccagaagcccactcagactgcagcacc
agcccagaggacagcgaggctcccaccagcaccagccccttcttgacctccccggctggc
tcccagaccagtcaggggcacggagggggcatcacccacgcctggggggacaccatcctc
acgagtgctcccatctctttctcctccacgggaaagcccattctgggttcagggcctgtg
ctcttctgggtgctggtcgcgcttatgacggtcatcggctccatctctttcctcttgtgc
cacaggagggcctgcaagaagtggattcggcagaagctccacctgtgctacccagtccag
accttccagcccaagctggagcctgcggattccaggtctgggaagagccttacgcagtca
aagagaagcgcgtctgtggcagagctgagcacaggagaactggggctcatgggtgcccca
gctgtgaagacctgccccagtgtgggggcagcctgcctggagagcctgcaactgctggat
gccagcccggctgagagccctggaccctcgaggaaccctcctgagccccgagtggccacg
gagcagaccaataacaggattgagaaaatctacatcatgaaggctgacacagtgatcgtg
gggaccgtgaagactgaggtgcctgagggccggagcctggtggggccagcggggcccgag
tttgaagaggacctggaagtggaccatgccccccactacccggagcaggagacagaacca
cctctgggcagctgcagggacgtcatgttctcggtggaggaggaagggaaggagggcccc
ttgcccacgactgtctctgggaaatga

DBGET integrated database retrieval system