KEGG   Manis javanica (Malayan pangolin): 108403838
Entry
108403838         CDS       T06054                                 
Name
(RefSeq) N-acetylaspartylglutamate synthase A-like
  KO
K18311  N-acetylaspartylglutamate/N-acetylaspartylglutamylglutamate synthase [EC:6.3.2.41 6.3.2.42]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv00250  Alanine, aspartate and glutamate metabolism
mjv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    108403838
Enzymes [BR:mjv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.41  N-acetylaspartylglutamate synthase
     108403838
    6.3.2.42  N-acetylaspartylglutamylglutamate synthase
     108403838
SSDB
Motif
Pfam: RimK Rimk_N
Other DBs
NCBI-GeneID: 108403838
NCBI-ProteinID: XP_017526681
LinkDB
Position
Unknown
AA seq 249 aa
MCSQLWFLTDRRIREDYPQVQILRALRQRCSEQDVRFRAVLMDQIAVTVVGGHLGLQLNQ
KALTTFPDVVLVRVPTPSVQSDSDITVLRHLEKLGCRLVNRPQSILNCINKFWTFQELAG
HGVPMPDTFSYGGHEDFSKMIDEAEPLGYPVVVKSTRGHRGQCCSRWVPAGAVALPQQSP
HQACTQYTVGPLSLMKSTYAAESSPPAVSEQAPPNDVQMAYAQGIWSEKSTLNGHVMSHS
CDGGTVQWK
NT seq 750 nt   +upstreamnt  +downstreamnt
atgtgctcccagctctggttcctgacggaccggcgcatccgcgaggactacccgcaggtg
cagatcctgcgcgccctccggcagcgctgctcggagcaggacgtgcgcttccgggcggtg
ctcatggaccagatcgccgtcactgtcgtcggcggccacctcggccttcagctgaaccaa
aaggctctcaccactttcccggatgtggtgcttgttcgggtgcccacaccctccgtgcag
tcagacagtgacatcacagtcctgcgacacttggagaagttgggctgccgcttagtcaac
cgcccacagagcattttaaactgcatcaacaagttctggacattccaagagctggctgga
catggtgtccccatgccagacaccttctcctatggtgggcatgaagacttttcaaaaatg
attgatgaagccgagcccctgggctacccggttgtggtgaagagcacgcgaggacaccgg
ggtcagtgctgctcccgctgggttcccgctggggctgtggctctgccccaacagagccct
catcaggcgtgtacccagtacacagtggggcccctgtcattgatgaagagcacgtatgca
gcagaaagcagtcctcctgcggtgtctgagcaggcacctcctaatgacgtccagatggca
tatgctcagggcatctggagtgagaagagtaccctaaatggacatgtgatgagccattcc
tgtgatggagggactgtgcagtggaaatga

DBGET integrated database retrieval system