KEGG   Manis javanica (Malayan pangolin): 108409348
Entry
108409348         CDS       T06054                                 
Symbol
MRAP
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04927  Cortisol synthesis and secretion
mjv04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    108409348 (MRAP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    108409348 (MRAP)
SSDB
Motif
Pfam: MRAP PAG
Other DBs
NCBI-GeneID: 108409348
NCBI-ProteinID: XP_017535354
LinkDB
Position
Unknown
AA seq 109 aa
MAHRPNASALDYSYEYYLDYLDLLPVDEKKLKANKHAVVIAFWVSLAALVALLFLFLLCM
SCSSSPQTRIPRRGRPAVPPGGWASAPAPRPGSFKKSLKNTGGIQSVNF
NT seq 330 nt   +upstreamnt  +downstreamnt
atggcccacaggcccaatgcttctgccctggactacagctacgagtactacctggactac
ttggacctccttcccgtggatgagaagaagctgaaagccaacaaacacgcggttgtcatt
gccttctgggtgagcctggctgccctcgtggcgcttctcttcctcttcctgctctgcatg
tcctgctcaagctccccacagacgaggatcccaaggcgcggccgaccggcggttccgcca
ggaggatgggcctccgcccccgcgccgaggccaggatcatttaaaaagagtctaaagaac
actggaggcatacaaagtgtaaatttttaa

DBGET integrated database retrieval system