KEGG   Mycobacterium sp. KMS: Mkms_5626
Entry
Mkms_5626         CDS       T00442                                 
Name
(GenBank) ring hydroxylating dioxygenase, alpha subunit
  KO
K11943  PAH dioxygenase large subunit [EC:1.13.11.-]
Organism
mkm  Mycobacterium sp. KMS
Pathway
mkm00624  Polycyclic aromatic hydrocarbon degradation
mkm01100  Metabolic pathways
mkm01120  Microbial metabolism in diverse environments
mkm01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mkm00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00624 Polycyclic aromatic hydrocarbon degradation
    Mkms_5626
Enzymes [BR:mkm01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.-
     Mkms_5626
SSDB
Motif
Pfam: Ring_hydroxyl_A Rieske
Other DBs
NCBI-ProteinID: ABL94808
UniProt: A1UPQ0
LinkDB
Position
pMKMS01:138142..139518
AA seq 458 aa
MTTETTETTGTADATDPYLRRALREVADGLKVGRLPARVVSDPALHTIEMERIFGRAWVF
LGHESELAKSGDFVVRHIGADSVIVCRDNSGRIQALSNSCRHRGALVCRAEMGNTAHFQC
PYHGWVYSNTGELVGVPAMSEAYPGGFDKSQWGLRHIPHVDSYAGFIFGSVDPKAPSLTD
YLGDTTFYLDLIAKKTAGGLEVIGAPHRWVMSANWKTAADNFVGDSYHTLFAHRSMVELG
MAPGDPNFASAPAEISLQNGHGVGVLGFPPTLADFPEYEGYPDEVVDQMATSYPSPVHKD
LMRRSSFIHGTVFPNLSFINVTLAPDHMSPPTPFITFRVWHPLSHDRMEILSWFLVERDA
PEWLRDASQASYVNNFGPGGVFEQDDAEAWKAITESVQGPFAGEGLLNYEMGMDLTPLTD
WPGPGEALPSGYAEQNQRRFWGRWLEYMGQPPAFGGRA
NT seq 1377 nt   +upstreamnt  +downstreamnt
atgaccaccgaaacaaccgaaaccaccggcacagctgacgcgaccgatccctacctgcgg
cgcgcgttgcgggaggtagcggacgggctcaaggtcgggcgcttaccggcccgcgtcgtc
agcgatcccgcgctacacacgatcgagatggagcggatcttcgggcgcgcctgggtgttt
ctcggacacgagtcggagttggccaagtccggcgacttcgtcgtgcggcacatcggggcc
gattcggtgatcgtttgccgggacaactccggccgcatccaggcgctgtccaattcttgt
cgccaccgtggtgcgctcgtgtgccgcgctgagatgggaaacaccgcgcacttccaatgc
ccgtaccacggctgggtgtacagcaacaccggagagctcgtcggcgtgccggcgatgagt
gaggcctatcccggcggcttcgacaagtcgcagtggggattacgtcacatcccccatgtc
gactcgtacgccggattcatcttcggcagcgtcgatccgaaggcgccgagcctgaccgac
tacctcggcgacacgacgttctacctcgacctcattgcgaagaagacagcgggcggtctg
gaggtgataggggcaccgcatcgatgggtgatgtcagcgaactggaagacagccgccgac
aattttgtcggcgactcctaccacaccctctttgctcaccgctcgatggtcgagctaggc
atggcgcccggtgacccaaacttcgcgagcgcaccagcggagatctcgctgcagaacggc
cacggcgtcggcgtactcggctttccgcccacgctcgccgattttcccgagtacgaggga
taccccgacgaagtcgtcgaccagatggcgacgtcctacccgtcgccggtacacaaggac
ctgatgcgacgctcatcctttattcacggcaccgtgttcccgaatttgtcgttcatcaac
gtgaccctcgcgccggaccacatgtcgccccctacccccttcatcacgttccgggtatgg
catccgctctcccatgatcggatggagatcctctcctggttcctggtcgaacgcgatgct
ccggaatggttgcgcgatgcgtcccaggcgtcctacgtcaacaacttcggcccaggtggg
gttttcgaacaggacgacgccgaggcatggaaggccatcaccgaatctgtccagggcccg
ttcgccggtgaaggcctgctgaactacgaaatgggcatggacttgactccgctcaccgac
tggccagggccgggagaggccctcccgagcgggtacgccgagcagaatcagcggcggttt
tgggggagatggctggaatacatgggtcagcctcccgcattcggcgggcgtgcttga

DBGET integrated database retrieval system