Myotis lucifugus (little brown bat): 111825710 Help Entry 111825710         CDS       T07795                                  Symbol FGF2 Name (RefSeq) fibroblast growth factor 2   KO K18497   fibroblast growth factor 2 Organism mlf  Myotis lucifugus (little brown bat) Pathway mlf01521   EGFR tyrosine kinase inhibitor resistance mlf04010   MAPK signaling pathway mlf04014   Ras signaling pathway mlf04015   Rap1 signaling pathway mlf04020   Calcium signaling pathway mlf04151   PI3K-Akt signaling pathway mlf04550   Signaling pathways regulating pluripotency of stem cells mlf04810   Regulation of actin cytoskeleton mlf05167   Kaposi sarcoma-associated herpesvirus infection mlf05200   Pathways in cancer mlf05205   Proteoglycans in cancer mlf05207   Chemical carcinogenesis - receptor activation mlf05218   Melanoma mlf05224   Breast cancer mlf05226   Gastric cancer Brite KEGG Orthology (KO) [BR:mlf00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     111825710 (FGF2)    04014 Ras signaling pathway     111825710 (FGF2)    04015 Rap1 signaling pathway     111825710 (FGF2)    04020 Calcium signaling pathway     111825710 (FGF2)    04151 PI3K-Akt signaling pathway     111825710 (FGF2)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     111825710 (FGF2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     111825710 (FGF2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     111825710 (FGF2)    05205 Proteoglycans in cancer     111825710 (FGF2)    05207 Chemical carcinogenesis - receptor activation     111825710 (FGF2)   09162 Cancer: specific types    05226 Gastric cancer     111825710 (FGF2)    05218 Melanoma     111825710 (FGF2)    05224 Breast cancer     111825710 (FGF2)   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     111825710 (FGF2)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     111825710 (FGF2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mlf04052]     111825710 (FGF2)    00536 Glycosaminoglycan binding proteins [BR:mlf00536]     111825710 (FGF2) Cytokines and neuropeptides [BR:mlf04052]  Cytokines   Growth factors (RTK binding)    111825710 (FGF2) Glycosaminoglycan binding proteins [BR:mlf00536]  Heparan sulfate / Heparin   Growth factors/receptors    111825710 (FGF2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FGF IL1 Fascin DUF2807 Motif Other DBs NCBI-GeneID:  111825710 NCBI-ProteinID:  XP_023608546 LinkDB All DBs Position Unknown AA seq 119 aa AA seqDB search MASHHSQGVDSDTGEVVLEETDFFKLQLQAEERGVVSIKGVCANRYLAMKEDGRLQASKC VTDECFFFERLESNNYNTYRSRKYSSWYVALKRNGQYKLGPKTGPGQKAILFLPMSAKS NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggcatcacatcacagccagggtgtcgacagcgacacaggcgaggttgtattggaggaa actgatttcttcaaactccaacttcaagcagaagagagaggggtcgtgtctatcaaagga gtgtgtgccaaccgctatctcgctatgaaggaggacggccggttacaggcttctaaatgt gttacggatgagtgtttcttttttgaacggttggaatccaataactacaacacttaccgg tcaagaaagtactccagttggtatgtggcattgaagcggaatgggcagtataaacttgga cccaaaacaggacctggccagaaagccatactttttcttcccatgtctgctaagagctga

DBGET integrated database retrieval system