Mycobacterium liflandii: MULP_04772 Help Entry MULP_04772        CDS       T02444                                  Name (GenBank) hypothetical protein   KO K04093   chorismate mutase [EC:5.4.99.5] Organism mli  Mycobacterium liflandii Pathway mli00400   Phenylalanine, tyrosine and tryptophan biosynthesis mli01100   Metabolic pathways mli01110   Biosynthesis of secondary metabolites mli01230   Biosynthesis of amino acids Brite KEGG Orthology (KO) [BR:mli00001]  09100 Metabolism   09105 Amino acid metabolism    00400 Phenylalanine, tyrosine and tryptophan biosynthesis     MULP_04772 Enzymes [BR:mli01000]  5. Isomerases   5.4  Intramolecular transferases    5.4.99  Transferring other groups     5.4.99.5  chorismate mutase      MULP_04772 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CM_2 Knl1_RWD_C Motif Other DBs NCBI-ProteinID:  AGC64278 UniProt:  L7VCU3 LinkDB All DBs Position 5197477..5197749 Genome browser AA seq 90 aa AA seqDB search MNTETIDTEDLPSIDELREEIDRLDREILAAVKRRAEVSQAIGKARMASGGTRLVHNREM KVIERYSELGPEGKDLAILLLRLGRGRLGH NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaccgaaacaatcgacactgaagatctccccagcattgacgagctgcgcgaagag atcgaccggttggaccgcgagatcctggccgcggtcaagcggcgcgccgaggtgtctcag gcgatcggcaaggcccggatggcctccggcggcacccgactggtgcacaaccgcgagatg aaggtcatcgagcgctacagcgagctgggacccgagggtaaagacctggcaattctgctt ttgcggttgggtagaggtcgactcggccactaa

DBGET integrated database retrieval system