KEGG   Melampsora larici-populina: MELLADRAFT_104776
Entry
MELLADRAFT_104776 CDS       T03138                                 
Name
(RefSeq) hypothetical protein
  KO
K21820  unspecific peroxygenase [EC:1.11.2.1]
Organism
mlr  Melampsora larici-populina
Brite
KEGG Orthology (KO) [BR:mlr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MELLADRAFT_104776
Enzymes [BR:mlr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.2  Peroxygenases
    1.11.2.1  unspecific peroxygenase
     MELLADRAFT_104776
SSDB
Motif
Pfam: Peroxidase_2
Other DBs
NCBI-GeneID: 18922391
NCBI-ProteinID: XP_007408312
JGI: Mellp1_104776
UniProt: F4RFV5
LinkDB
Position
Unknown
AA seq 397 aa
MIHEYHVLTCLHTLADHSTVIVNPYQSEGLSLNWFAERAGASNLTPEQRGPQSQQLLDLV
HLIPKHISTKATLLLAVLNLKPVLPTGRKRIPDDDHPFMPPGPNDIRGGCPGLNIMANYG
YISRNGITDVGEMMYGMQEMLGFAFDTAAIVTTLGIKSSTDLTTLKASIGRTDSRTDGPL
SGLFGTAPGFFSENAHNKFEIDGSLTRVDGYFANGDTDHFDSDHWKKYRQLAIDHFGGVM
DFKFEGAARFMQYKECREKNPECTWAPGEQLSLYIAQAFVSDTMTSADENGNLLPPDVRS
IETFLGIVENPDGTFSRTAGKLPPGPDGHWYRRSVPLAFVEQALSLRETLLAYPVSALLK
EYHMGGVFIPLSFACSPTAGGVRAKQWKSWALGRRLN
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgattcatgagtatcacgttttgacttgtttacacactttagccgatcacagtactgtg
atcgtgaacccgtatcagtcggaagggctatccctaaactggttcgcggagcgtgccggc
gcgtcgaaccttacgcctgaacaacgggggccacaatcacagcagcttctggacttggtc
cacttgataccaaaacatatttccactaaggccaccttacttttagctgtgcttaatttg
aaacccgttcttccaactgggcgtaaacggatcccggatgatgaccatcccttcatgcca
cccggacccaatgacattagaggtggttgtccaggtctcaacataatggcaaattatggt
tatatctctcgcaatggcatcaccgacgtgggtgaaatgatgtacgggatgcaagagatg
ctaggatttgctttcgatactgctgcaatcgttactacgctgggcatcaaatcttccacc
gatctcacaacacttaaagcctccattggtcgaacggactctaggaccgacgggcccctt
tcgggactttttggaaccgcacctggtttcttttccgaaaatgctcacaataagtttgaa
atcgatggatctcttacacgcgttgacggatattttgcgaatggagataccgatcatttt
gatagcgatcattggaaaaaatatcgacaacttgccatcgatcactttggaggcgtgatg
gatttcaagttcgaaggagcagccaggtttatgcagtacaaagaatgtcgggaaaaaaac
cccgagtgtacatgggcccctggagaacagctttcactctatatagctcaggcctttgtc
tctgacacaatgacatccgccgacgaaaacggaaacctactacctcccgatgtgcgatct
attgagacgttccttgggatcgttgaaaatccagatggaacgttttcacgtaccgctggc
aaactgccacccggtcccgatgggcattggtatcgccgttcagtaccccttgcgtttgtc
gagcaggcgttgagtctacgcgagacattgcttgcttatcccgtaagtgctttgcttaag
gaatatcatatgggaggagttttcatcccgctttcttttgcttgttctccaacggcaggt
ggagttcgggcgaaacaatggaaatcttgggcattgggacgcagacttaactga

DBGET integrated database retrieval system