KEGG   Melampsora larici-populina: MELLADRAFT_75279
Entry
MELLADRAFT_75279  CDS       T03138                                 
Name
(RefSeq) hypothetical protein
  KO
K21820  unspecific peroxygenase [EC:1.11.2.1]
Organism
mlr  Melampsora larici-populina
Brite
KEGG Orthology (KO) [BR:mlr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MELLADRAFT_75279
Enzymes [BR:mlr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.2  Peroxygenases
    1.11.2.1  unspecific peroxygenase
     MELLADRAFT_75279
SSDB
Motif
Pfam: Peroxidase_2
Other DBs
NCBI-GeneID: 18932635
NCBI-ProteinID: XP_007412947
JGI: Mellp1_75279
UniProt: F4RV08
LinkDB
Position
Unknown
AA seq 406 aa
MLSLLLIFSLFQYSQAFPRHYLERGFNSVASNISAASLENLKARGLLDLGDVIGLLPTSL
DLGPVVSIGRKRIPDDDHPFKAPGPNDIRGGCPGLNIMANYGYISRDGITNVVELIYAQQ
EMLGLAPDLAIGITMLGVRAAVDITTLKMSIGKTDSRTDGPLSGLFGTAPGLFSSLAHNK
FEIDGSLSRPDRYFEHGDSDHFDSNYWKKFRNLAFKRYNGLMTREFVGEARYMQYTTCRD
TNPECEWALGEQLVHTSESFLAYALASADVHGNPSPPHVKDIEIFFGIIENPDGSFSRGN
GKLPPSPDGHWYRRATPLTLAEQFLSLKDTFLAYPMPFGRNNGSLGHWSESLTDLRNVEE
NNMLCYLLQQTRDPKHSRYSKFPLVNDAFGKLLKNTLAPLFEQLSC
NT seq 1221 nt   +upstreamnt  +downstreamnt
atgttatcattattacttatattctcactctttcaatactcacaggcatttcctcgccac
tatctggaacgagggttcaactcggttgcctctaacatatcagctgctagcctcgagaac
ctaaaagctcgtggacttttggacttgggagatgtgattggcttgttaccaaccagcctc
gatttgggacccgtagtctctattggacgaaagcgaattccagacgatgaccatcctttc
aaagcacctggtcctaatgatatcagaggtggttgccccggtctcaatattatggcgaac
tacggttatatctctcgagatggtatcaccaatgttgttgaactgatttatgcacagcaa
gaaatgctaggattggctcccgaccttgccataggtatcacgatgcttggagtaagagct
gccgtcgatatcacaacattgaagatgtcaattggtaaaacagactcgcgaaccgatgga
ccattaagcggactgtttggaacggctcctggactcttttcgtcattggcacacaacaaa
tttgaaattgacggatctctttcgcgtcctgatcgttatttcgagcatggtgactcagat
cattttgatagcaactactggaagaagtttagaaatctggcttttaagcgctacaatgga
ctgatgaccagagaattcgtcggagaagcaagatacatgcagtacactacctgtcgtgac
acgaatcctgagtgtgaatgggctctaggagaacagctcgtacacacatcggagtctttc
cttgcctatgccttggcctcggccgatgtacacggtaatccatccccacctcatgtgaaa
gacattgaaatcttttttggtatcattgagaaccccgatggtagtttttcgcgcggtaat
gggaagctaccacctagtccggatggtcactggtatcgtcgtgcaacgcccttaacattg
gccgagcaattcttgagcttgaaagacactttccttgcatatcctatgccctttggaaga
aacaacggttctttgggacattggagtgagagcttgaccgaccttcgaaacgtagaggaa
aacaatatgctatgctacctccttcaacaaacacgcgaccctaaacactctagatactct
aaatttccattggtgaacgatgcctttggaaagctgcttaaaaatactctggcaccttta
ttcgaacagttgtcttgttga

DBGET integrated database retrieval system