KEGG   Methanosarcina lacustris: MSLAZ_0851
Entry
MSLAZ_0851        CDS       T03822                                 
Name
(GenBank) Methylcobalamin:coenzyme M methyltransferase, methanol-specific
  KO
K16954  methylthiol:coenzyme M methyltransferase [EC:2.1.1.251]
Organism
mls  Methanosarcina lacustris
Pathway
mls00920  Sulfur metabolism
mls01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mls00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    MSLAZ_0851
Enzymes [BR:mls01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.251  methylated-thiol---coenzyme M methyltransferase
     MSLAZ_0851
SSDB
Motif
Pfam: URO-D
Other DBs
NCBI-ProteinID: AKB74112
UniProt: A0A0E3S4K3
LinkDB
Position
1059154..1060257
AA seq 367 aa
MVSEMTPTRRALAAVLGGRVDYVPPANPLAQTTAELMQICNASWPKAHFDSKMMADLAAA
PYEVCGIEAARPQFDISLEAEVLGCKLDWDKPDRPPVTGPAYTDPADITWPDNLEETGRI
PVVLGAIDELRKRYEGMLPIIPVLTAPFTVAGHIAGVENLVRWTKTDPEKAHAFIEAATD
FVIAYGKLQTAYGAHILFPADPSASGDLISGETYKEFVLPAHKRMAREIGCPQILHICGD
TSKLLPYIKQSGIDCFSFDSVPVWYCRQVMGNEMSILGSLDVIDLMPNGTPEQVYNRTRE
CILQGTDIVGTACDVSFGTSLENLRAYVRACKETPIPKYDDVEDLVRQIGVGVGRNMKES
VLGGVQK
NT seq 1104 nt   +upstreamnt  +downstreamnt
atggtaagcgaaatgactccaacccgaagagctctggcagcagtgcttggaggtagagtt
gactacgtaccccctgcaaatcctctggctcagaccacggccgaactgatgcagatctgc
aatgcttcctggccaaaagcccactttgacagtaaaatgatggcagaccttgcagccgca
ccctatgaagtatgtggcattgaggctgcacgtcctcagtttgacatttccctggaagca
gaggttctggggtgcaaacttgactgggacaagcctgacaggcctcctgtaaccggacct
gcctatacggaccctgctgacataacctggccagacaacctggaagaaaccggaagaatt
ccggttgtgctcggagcaatcgatgaactgaggaaacgctacgaaggcatgctccctatc
atccccgtacttacagctccctttacggtagccggccacatagcaggcgttgaaaacctg
gtaagatggacaaagaccgacccggaaaaagcccatgcttttatagaggctgccacggac
tttgtaatagcctacggaaagctgcagactgcttacggggcacatatccttttccctgcc
gatccatcagcttcaggagatctgatttctggggaaacgtacaaagaattcgtgctccct
gcccacaaaaggatggcaagggaaataggctgtccccagatcctgcacatctgtggagat
accagcaaactcctgccttacataaagcagagcggaatcgactgcttctcctttgactct
gtgcctgtctggtactgccgccaggtaatgggaaacgagatgtctattctcggaagcctg
gacgtcatcgacctgatgccaaatggcactccggaacaggtctacaacaggaccagagaa
tgtatcttgcagggaactgatattgtcgggacagcctgtgacgtctcattcgggacctcc
ctcgaaaacctcagagcctatgtcagggcttgtaaggagacaccgatcccgaaatatgat
gacgtggaagacctcgtcaggcagataggggttggtgtcggaaggaacatgaaagaaagc
gtccttgggggagtgcagaaatga

DBGET integrated database retrieval system