KEGG   Mirounga leonina (Southern elephant seal): 118019995
Entry
118019995         CDS       T07472                                 
Symbol
TNFRSF8
Name
(RefSeq) tumor necrosis factor receptor superfamily member 8
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
mlx  Mirounga leonina (Southern elephant seal)
Pathway
mlx04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:mlx00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    118019995 (TNFRSF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mlx04050]
    118019995 (TNFRSF8)
   04090 CD molecules [BR:mlx04090]
    118019995 (TNFRSF8)
Cytokine receptors [BR:mlx04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   118019995 (TNFRSF8)
CD molecules [BR:mlx04090]
 Proteins
  118019995 (TNFRSF8)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 118019995
NCBI-ProteinID: XP_034875662
LinkDB
Position
Unknown
AA seq 507 aa
MFCATSAVNTCARCIPHSVCPTGMVVRFRGTAERDTICEEPSPVTSPDCSTSPEASQAPA
RRIGSAISGFSLGSRPPQARPLGTSSASSKARTTLPGGGASLTVENDSKMTRAPSSPSSV
RKPSPDPGLTSQQPCAQGSSDCGKQCDPDYYLDKDGRCKACVTCSGDLMEKAPCTWNSSR
VCECRSGMSCATSATNSCARCIPHSVCPPGMVTKPQGAAERDATDELPPSEARPECSTNP
EDSKTPTSAPAPLVSSADPQISQEHGGGITHAWGDTPISTSTPISFSSTAKPILVSGPML
FWTVLLLVVVLGSVSFLLCHRRACRKWIQQKLHLCYPVQTFRPKLEPVDSRPWRNPTQLK
SISVVESGMEELRLMSPPPVETSPNGAACLESMRLLEASPPAAGSPSSPRDLPEPRVTSE
HTNNRIEKIYIMKADTVIVGTVRTEVPEGRGLVGPAGPEFEEDLEVDHAPHFPEQETEPP
LGSCGDVMFSVEEEGKEAPLPMTVSEK
NT seq 1524 nt   +upstreamnt  +downstreamnt
atgttctgtgccacatcagccgtcaacacctgtgcccgctgcatcccccactccgtctgt
cccacagggatggtcgtcaggttccggggtacagcagagagggacaccatctgtgaggaa
ccctccccagtgaccagccctgactgcagcaccagccccgaagccagccaggcgcccgcc
aggagaattggcagtgccatttctggcttctctctcggcagcaggcccccccaggccagg
cccctggggacttcctcggcaagctccaaggccaggaccacgcttcctggagggggtgct
tccctcaccgtggaaaatgattccaaaatgaccagggcccccagctctccctcttcggtg
cggaagcccagtcccgatccggggctgacctcgcagcagccgtgcgcacaggggtcatcg
gactgtgggaagcagtgtgaccccgactactacctggacaaggacggccgctgcaaggcc
tgtgtgacctgttctggagacctgatggagaaggcgccgtgcacgtggaactcctctcga
gtctgcgaatgtcgatctggcatgtcctgtgccacatcagccaccaactcctgtgcccgc
tgtatcccccactccgtctgcccaccagggatggtcaccaaaccccagggtgcagctgag
agggatgccacagatgagctccctccctccgaggcccgccctgagtgcagcaccaaccca
gaggacagcaagacgcccaccagtgcccctgcccctctggtctcctcggcagacccccag
atcagtcaggagcatggagggggcatcacccacgcctggggagacacccccatatcaacg
agcacacccatctctttctcctccacggcaaagcccattctggtttcagggccgatgctc
ttctggacggtcctgctgctggtggtggtcctgggctccgtgtccttcctcctgtgccac
cggagggcctgcaggaagtggattcagcagaagctccacctctgctaccctgtccagacc
ttccggcccaagctggagcccgtggattccaggccctggaggaacccgacacagctgaag
agtatatcggtggtggagtcaggcatggaagagctgaggttaatgagccccccgcctgtg
gagacctcccccaatggggcagcctgcctagagagcatgcggctgctggaagccagccca
cccgccgctgggagcccctcatcccccagggaccttcccgagccccgggtgacctcagag
cataccaacaacaggatcgagaagatctacatcatgaaggctgacacagtgattgtgggg
accgtgaggactgaggtgcctgagggccggggcctggtggggccggcgggtcctgagttc
gaggaggatctggaagtggaccatgctccccacttcccagagcaggagacagagcctcct
ctgggcagctgcggggatgtcatgttctcagtagaagaggaaggaaaggaggcccccttg
cccatgaccgtctccgagaaatga

DBGET integrated database retrieval system