KEGG   Methanosarcina mazei Go1: MM_2427
Entry
MM_2427           CDS       T00082                                 
Symbol
mtsA
Name
(GenBank) Methylthiol:coenzyme M methyltransferase
  KO
K16954  methylthiol:coenzyme M methyltransferase [EC:2.1.1.251]
Organism
mma  Methanosarcina mazei Go1
Pathway
mma00920  Sulfur metabolism
mma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mma00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    MM_2427 (mtsA)
Enzymes [BR:mma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.251  methylated-thiol---coenzyme M methyltransferase
     MM_2427 (mtsA)
SSDB
Motif
Pfam: URO-D
Other DBs
NCBI-ProteinID: AAM32123
UniProt: Q8PUA8
LinkDB
Position
2896878..2897981
AA seq 367 aa
MVSEMTPTRRALAAVLGGRVDYVPPANPLAQTTTELMAICNASWPKAHFDSKMMADLAAA
SYEVCGIEAARPQFDISLEAEVLGCKLDWDKPDRPPVTGPAYTNPEDVTWPDKLEETGRI
PVVLGAIDELRKRYDGMLPIIPLLTAPFTVAGHIAGVENMARWTKTDPEKAHAFIDAATD
FVVAYGKLQAAYGAHILFLADPSASSSLISAETYREFVLPAHRRLAKEISCPQILHICGD
SSKLLPYIKQSGIDCFSFDTVPVWYCRQVIGNDMSILGSLDVIDLMPNGTPEQVYNRTRE
CILQGTDIVGTACGVSYGTPLENLRAYVRACKETPIPRYDDVEDLIRQIGVGIGRNMKEN
VLGGMQE
NT seq 1104 nt   +upstreamnt  +downstreamnt
atggtaagcgagatgactccaacccgccgagctctggcagcagtgctcggaggcagggtc
gattatgtaccccctgcaaaccccctggctcagaccacaacagaattaatggcaatctgc
aatgcttcctggccaaaagcccattttgacagcaaaatgatggcagatcttgcagccgct
tcttacgaagtttgtggcattgaggctgcgcgaccccagtttgacatctctcttgaagct
gaagttctggggtgtaaacttgactgggataagccagacaggcctccggtaacaggacca
gcttatacgaaccctgaagatgtgacctggcccgacaaactggaagaaaccggaaggatt
ccggtagttcttggagcaattgatgaactcaggaaacgttacgacgggatgctccctatc
atccccttactgaccgccccctttacggtagcaggtcacatagcaggcgttgaaaatatg
gcccggtggacaaaaaccgatcctgaaaaagcccatgccttcattgatgcagcaacagat
tttgttgtagcttacggaaagctgcaggctgcttacggggcgcatatcctcttccttgca
gatccttcggcttccagcagcctgatttctgcggaaacataccgggaatttgtactccct
gcccacagaagactggcaaaggaaataagctgcccccagatcctgcatatctgcggagat
tccagtaaactgctgccttatatcaagcagagcggaatcgactgcttctcctttgatacc
gtcccggtctggtactgccgtcaggtaattggcaacgatatgtccatactcggaagcctg
gacgtcatagacctgatgccaaacggaaccccagaacaggtttataacaggacccgggaa
tgcatactgcaggggacagatattgtagggactgcatgtggtgtatcatacgggaccccg
cttgaaaatctcagagcatatgtcagggcctgcaaagagactccaatcccaagatatgat
gacgttgaagatcttatcaggcagattggagtcggcatcgggcgaaacatgaaagaaaac
gttctgggagggatgcaggaatga

DBGET integrated database retrieval system