KEGG   Mycolicibacterium mageritense: MMAGJ_45200
Entry
MMAGJ_45200       CDS       T07395                                 
Symbol
hcaE_1
Name
(GenBank) hydrogenase
  KO
K11943  PAH dioxygenase large subunit [EC:1.13.11.-]
Organism
mmat  Mycolicibacterium mageritense
Pathway
mmat00624  Polycyclic aromatic hydrocarbon degradation
mmat01100  Metabolic pathways
mmat01120  Microbial metabolism in diverse environments
mmat01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mmat00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00624 Polycyclic aromatic hydrocarbon degradation
    MMAGJ_45200 (hcaE_1)
Enzymes [BR:mmat01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.-
     MMAGJ_45200 (hcaE_1)
SSDB
Motif
Pfam: Rieske Ring_hydroxyl_A
Other DBs
NCBI-ProteinID: BBX35238
LinkDB
Position
complement(4645405..4646817)
AA seq 470 aa
MIEQLRNGDSAVRPASMDPISEFLRTAESDLAGGVISPRIFNDPDLYEREMARIFARCWC
FVAHESEIPEPGDYVLRYIGQDQFIVVRDEDGLIHVLFNKCTHRGSTVCRVEKGNSSHFR
CPYHSWVFKNTGEWSGAPYRKKAYKKLDAGSWGLAAAPHVDSVHGLVFAALDPDAPTLDE
YLGDMRWYLDVLLGLNDSGMTTIGEPHRWRVPANWKSGAENFMADAYHVPSLHRSAEDVG
MFPRIETGGAGPQGVSRHVYFEHGHGMIVNNGFLPPPWHTSGYPPEVAETFQLERLTPLQ
RQFVENHSATTFLIFPNFGLVRVPAAPHPDAPPMVFTHLRQWQPVGPDGIVNWNWTLGWK
SAPAGLNEDAYIAGLSMHGPAGILEQDDTVVWGGAPQAGKSVFARKCGMRFNFQLGLDGM
SDYAEDTDWQYPGIATTTALGEAPQRAFYRRWLREMTPAAQELTENGARS
NT seq 1413 nt   +upstreamnt  +downstreamnt
ttgatcgagcagttacgcaatggcgattcggcggttcggcccgcatcaatggacccgata
tcggagtttctccgcaccgccgaatccgacctcgcaggcggcgtgatatcgccacgcatc
ttcaatgaccctgacctctacgaacgggaaatggcacggattttcgcccgctgctggtgc
ttcgtcgcgcacgagtcggagatccccgaaccgggcgactatgtgctccgctacatcggg
caggaccaattcatcgtcgtccgggacgaagacgggttgatccacgttctgttcaacaaa
tgcacgcaccgcggtagcacggtgtgccgcgtcgagaagggcaacagctcccatttccga
tgcccttatcactcatgggttttcaagaatacgggcgaatggagtggggcgccctaccgg
aagaaggcatacaagaagctcgatgccggcagctgggggctcgcggcggccccgcacgtg
gattcggtgcacggtctggtgttcgccgcgctcgatcccgacgctcccacgctcgacgag
tacctcggcgacatgcgctggtacctcgacgtcctgctcggcctgaacgactcgggaatg
acgaccatcggcgaaccgcaccgctggcgggtaccggccaattggaagtctggcgcggag
aacttcatggccgacgcctaccacgtcccgtcactacaccgctctgccgaggacgtcggc
atgttcccccggatcgagaccggaggggcgggcccgcagggcgtgtcccggcatgtgtac
ttcgaacacggccacggcatgatcgtcaacaacggcttccttcctccgccgtggcacacc
tccggatacccgccggaggtcgccgagaccttccagctcgagcggttgacgcccttgcag
cgtcagttcgtcgaaaaccactcggccacaacgttcctcatcttcccgaacttcggtctg
gtccgcgtgcccgctgcaccgcatcccgacgcgccgccgatggtgttcacccacctacgt
cagtggcagccggtcgggcccgatggcatcgtcaactggaactggaccctcggctggaag
tccgcacccgccggattgaacgaggacgcctacatcgccggactgagcatgcacggcccg
gccggcatcctcgagcaggacgacaccgtggtgtggggcggcgcaccgcaagccggcaaa
tcggtgttcgcccggaaatgcggtatgcgtttcaattttcagctcggtctcgacggcatg
agtgactatgccgaggacacggactggcagtatcccggtatcgccacgaccaccgcgctc
ggcgaggcaccgcagcgggccttctaccgccgctggcttcgcgagatgacgcccgccgca
caagaactgaccgagaacggagcgcgctcgtga

DBGET integrated database retrieval system