KEGG   Methanosarcina mazei Tuc01: MmTuc01_2485
Entry
MmTuc01_2485      CDS       T02477                                 
Name
(GenBank) methylcobalamin:coenzyme M methyltransferase
  KO
K16954  methylthiol:coenzyme M methyltransferase [EC:2.1.1.251]
Organism
mmaz  Methanosarcina mazei Tuc01
Pathway
mmaz00920  Sulfur metabolism
mmaz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmaz00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    MmTuc01_2485
Enzymes [BR:mmaz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.251  methylated-thiol---coenzyme M methyltransferase
     MmTuc01_2485
SSDB
Motif
Pfam: URO-D
Other DBs
NCBI-ProteinID: AGF97795
UniProt: M1Q620
LinkDB
Position
2470884..2471987
AA seq 367 aa
MVSEMTPTRRALAAVLGGRVDYVPPANPLAQTTTELMAICNASWPKAHFDSKMMADLAAA
SYEVCGIEAARPQFDISLEAEVLGCKLDWDKPDRPPVTGPAYTNPEDVTWPDKLEETGRI
PVVLGAIDELRKRYDGMLPIIPLLTAPFTVAGHIAGVENMARWTKTDPEKAHAFIDAATD
FVVAYGKLQAAYGAHILFLADPSASSSLISAETYREFVLPAHRRLAKEISCPQILHICGD
SSKLLPYIKQSGIDCFSFDTVPVWYCRQVIGNDMSILGSLDVIDLMPNGTPEQVYNRTRE
CILQGTDIVGTACGVSYGTPLENLRAYVRACKETPIPRYDDVEDLIRQIGVGIGRNMKEN
VLGGMQE
NT seq 1104 nt   +upstreamnt  +downstreamnt
atggtaagcgagatgactccaacccgccgagctctggcagcagtgctcggaggcagggtc
gattatgtaccccctgcaaaccccctggctcagaccacaacagaattaatggcaatctgc
aatgcttcctggccaaaagcccattttgacagcaaaatgatggcagatcttgcagccgct
tcttacgaagtttgtggcattgaggctgcgcgaccccagtttgacatctctcttgaagct
gaagttctggggtgtaaacttgactgggataagccagacaggcctccggtaacaggacca
gcttatacgaaccctgaagatgtgacctggcccgacaaactggaagaaaccggaaggatt
ccggtagttcttggagcaattgatgaactcaggaaacgttacgacgggatgctccctatc
atccccttactgaccgccccctttacggtagcaggtcacatagcaggcgttgaaaatatg
gcccggtggacaaaaaccgatcctgaaaaagcccatgccttcattgatgcagcaacagat
tttgttgtagcttacggaaagctgcaggctgcttacggggcgcatatcctcttccttgca
gatccttcggcttccagcagcctgatttctgcggaaacataccgggaatttgtactccct
gcccacagaagactggcaaaggaaataagctgcccccagatcctgcatatctgcggagat
tccagtaaactgctgccttatatcaagcagagcggaatcgactgcttctcctttgatacc
gtcccggtctggtactgccgtcaggtaattggcaacgatatgtccatactcggaagcctg
gacgtcatagacctgatgccaaacggaaccccagaacaggtttataacaggacccgggaa
tgcatactgcaggggacagatattgtagggactgcatgtggtgtatcatacgggaccccg
cttgaaaatctcagagcatatgtcagggcctgcaaagagactccaatcccaagatatgat
gacgttgaagatcttatcaggcagattggagtcggcatcgggcgaaacatgaaagaaaac
gttctgggagggatgcaggaatga

DBGET integrated database retrieval system