KEGG   Mycobacterium sp. MCS: Mmcs_1642
Entry
Mmcs_1642         CDS       T00367                                 
Name
(GenBank) ring hydroxylating dioxygenase, alpha subunit
  KO
K11943  PAH dioxygenase large subunit [EC:1.13.11.-]
Organism
mmc  Mycobacterium sp. MCS
Pathway
mmc00624  Polycyclic aromatic hydrocarbon degradation
mmc01100  Metabolic pathways
mmc01120  Microbial metabolism in diverse environments
mmc01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mmc00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00624 Polycyclic aromatic hydrocarbon degradation
    Mmcs_1642
Enzymes [BR:mmc01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.-
     Mmcs_1642
SSDB
Motif
Pfam: Ring_hydroxyl_A Rieske
Other DBs
NCBI-ProteinID: ABG07752
UniProt: A0A5Q5BHU7
LinkDB
Position
1779570..1780937
AA seq 455 aa
MTTETTGTADATDPYLRRALREVADGLKVGRLPARVVSDPALHTIEMERIFGRAWVFLGH
ESELAKSGDFVVRHIGADSVIVCRDNSGRIQALSNSCRHRGALVCRAEMGNTAHFQCLYH
GWVYSNTGELVGVPAMTEAYPGGFDKSQWGLRHIPHVDSYAGFIFGSVDPKAPSLTDYLG
DTTFYLDLIAKKTAGGLEVIGAPHRWVMSANWKTAADNFVGDSYHTLFAHRSMVELGMAP
GDPNFASAPAEISLQNGHGVGVLGFPPTLADFPEYEGYPDEVVDQMATSYPSPVHKDLMR
RSSFIHGTVFPNLSFINVTLAQDHMSPPTPFITFRVWHPLSHDRMEILSWFLVERDAPEW
LRDASQASYVNNFGPGGVFEQDDAEAWKAITESVQGPFAGEGLLNYEMGMDLTPLTDWPG
PGEALPSGYAEQNQRRFWGRWLEYMGQPPAFGGRA
NT seq 1368 nt   +upstreamnt  +downstreamnt
atgaccaccgaaacaaccggaacagctgacgcgaccgatccctacctgcggcgcgcgttg
cgggaggtagcggacgggctcaaggtcgggcgcttaccggcccgcgtcgtcagcgatccc
gcgctacacacgatcgagatggagcggatcttcgggcgcgcctgggtgtttctcggacac
gagtcggagttggccaagtccggcgacttcgtcgtgcggcacatcggggccgattcggtg
atcgtttgccgggacaactccggccgcatccaggcgctgtccaattcttgtcgccaccgt
ggtgcgctcgtgtgccgggcggagatgggaaacaccgcgcacttccaatgcctgtaccac
ggctgggtgtacagcaacaccggagagctcgtcggcgtgccggcgatgacggaggcctat
cccggcggcttcgacaagtcgcagtggggattacgtcacatcccccatgtcgactcgtac
gccggattcatcttcggcagcgtcgatccgaaggcgccgagcctgaccgactacctcggc
gacacgacgttctacctcgacctcattgcgaagaagacagcgggcggtctggaggtgata
ggggcaccgcatcgatgggtgatgtcagcgaactggaagacagccgccgacaattttgtc
ggcgactcctaccacaccctctttgctcaccgctcgatggtcgagctaggcatggcgccc
ggtgacccaaacttcgcgagcgcaccagcggaaatctcgctgcagaacggccacggcgtc
ggcgtactcggctttccgcccacgctcgccgattttcccgagtacgagggataccccgac
gaagtcgtcgaccagatggcgacgtcctacccgtcgccggtacacaaggacctgatgcga
cgctcatcctttattcacggcaccgtgttcccgaatttgtcgttcatcaacgtgaccctc
gcgcaggaccacatgtcgccccctacccccttcatcacgttccgggtatggcatccgctc
tcccatgatcggatggagatcctctcctggttcctggtcgaacgcgatgctccggaatgg
ttgcgcgatgcgtcccaggcgtcctacgtcaacaacttcggcccaggtggggttttcgaa
caggacgacgccgaggcatggaaggccatcaccgaatctgtccagggcccgttcgccggt
gaaggcctgctgaactacgaaatgggcatggacttgactccgctcaccgactggccaggg
ccgggagaggccctcccgagcgggtacgccgagcagaatcagcggcggttttgggggaga
tggctggaatacatgggtcagcctcccgcattcggcgggcgtgcttga

DBGET integrated database retrieval system