KEGG   Molossus molossus (Pallas's mastiff bat): 118617474
Entry
118617474         CDS       T07221                                 
Name
(RefSeq) LOW QUALITY PROTEIN: melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
mmf  Molossus molossus (Pallas's mastiff bat)
Pathway
mmf04927  Cortisol synthesis and secretion
mmf04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:mmf00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    118617474
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    118617474
SSDB
Motif
Pfam: MRAP FixQ
Other DBs
NCBI-GeneID: 118617474
NCBI-ProteinID: XP_036099312
LinkDB
Position
Unknown
AA seq 148 aa
MANRSNASAPYYSYEYYLDYLDLLPVDEKELRAHKHSIAIAFWVSLAAFVVLLFLMLLYM
PWPGSPRARNSLHRSTSPWSFRLNLPPCVRRHLLLHRAPRGTPQAPPSSARGPGSRTPSP
SASPPTAPQAHSALXWEQALDEDPLGIS
NT seq 447 nt   +upstreamnt  +downstreamnt
atggccaacaggtccaacgcgtccgccccgtactacagctacgagtactacctggactac
ctggacctcctccccgtggacgagaaggagctgagggcccacaagcactccatcgccatc
gccttctgggtgagcctggcggccttcgtggtgctgctgttcctcatgctgctctacatg
ccctggccgggctccccgcgcgccaggaacagcctgcaccgcagcaccagcccctggagt
ttccgcctcaacctccccccctgtgtccggaggcacctcctgctccacagggctccacga
ggcaccccgcaggccccaccgagctcagccagggggccaggcagcagaacacccagccct
tctgcctcgccccccactgcgccccaggcccactctgctctcnnctgggaacaggccctc
gatgaggaccccctgggcatcagctga

DBGET integrated database retrieval system