KEGG   Molossus molossus (Pallas's mastiff bat): 118626534
Entry
118626534         CDS       T07221                                 
Symbol
TNFRSF8
Name
(RefSeq) tumor necrosis factor receptor superfamily member 8
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
mmf  Molossus molossus (Pallas's mastiff bat)
Pathway
mmf04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:mmf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    118626534 (TNFRSF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmf04050]
    118626534 (TNFRSF8)
   04090 CD molecules [BR:mmf04090]
    118626534 (TNFRSF8)
Cytokine receptors [BR:mmf04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   118626534 (TNFRSF8)
CD molecules [BR:mmf04090]
 Proteins
  118626534 (TNFRSF8)
SSDB
Motif
Pfam: TNFR_c6 ASFV_J13L
Other DBs
NCBI-GeneID: 118626534
NCBI-ProteinID: XP_036112253
LinkDB
Position
Unknown
AA seq 605 aa
MFALHAVMGLLLLGVLRAFPQGRAPTDPCVGDPSRYYDEAAGRCCYRCPEGLSPKQLCPQ
GPSDCRKQCEPDYYLNGQNRCTACVSCGDDLVEKKPCSWNSPRVCECRAGMFCLTSAAHS
CARCAPHSVCSAEMIVKFPGTAERDTICESPSPGASPDCGTSPEDCKAPASGTSPQAMPI
PTSASSRARTMLLGEDTPRAPEDDAKMMRAPNSLSSEGKPSLDPGLSPQHLCPLGSADCR
KQCEPDYYLDRDGRCTACVSCSGGDLVEKTPCTWNSSRVCECRPGMFCVTSATNSCARCT
ACPIIDPEVATKLQGKAEKDTTYEPSNPGTHLNCSTNPEDSEVPASTSPSWISPADSQAS
EGRGGGATHARWDASISTSAPVSFSSSGRTILVSGSVLFWAIVVLVVVMGTSSFLLYHRK
ACWKWIRQKLHLCYPVQTFQLMPEPVDSRPQRTHTEWKGSVLVAQPCTEVLGLMSPPSVE
TSPNMGAACLESLPLVGASPAGSPSSPRDLPEPRVTTEHTNNRIEKIYIMKADTVIVGTV
KTEVPEGRGLAGPAEPELEEDLEVDHAPHYPEQETEPPLGSCRDVMFSVEEEGKADPLPT
TASGK
NT seq 1818 nt   +upstreamnt  +downstreamnt
atgttcgctctccacgcagtgatgggactgttgctcctgggggtgctccgagccttcccg
cagggtcgagcccccacggacccctgtgtgggagaccccagccgctactatgacgaggcc
gccgggaggtgctgttaccgctgccctgaggggctgtccccgaagcagctgtgtccgcag
gggccatccgactgcaggaagcagtgtgagccggactactacctgaacgggcagaaccgc
tgcacggcctgtgtgagctgcggagatgatcttgtggagaagaagccgtgttcgtggaac
tccccccgtgtctgtgaatgccgggctggcatgttctgtctcacgtcagccgcccactcc
tgtgcccgctgcgccccccactccgtctgctccgcagagatgattgtcaagtttccgggc
acagcggagagggacaccatctgtgagtcaccttccccaggggccagccctgactgtggc
accagcccggaggactgcaaggcacctgccagtggcacctctccgcaggccatgcccatc
ccgacctcagccagctcccgtgccaggaccatgcttcttggagaggacactccccgcgcc
ccagaagatgatgccaaaatgatgagggctcccaactctctctcctcggaggggaagccc
agtctggatccagggttgtccccgcagcacctgtgccctctggggtccgctgactgcagg
aagcagtgtgagccggactactacttggacagggatggccgctgcacggcctgtgtgagc
tgctcaggaggtgacctcgtggagaagacaccttgcacgtggaattcctcgcgggtctgc
gaatgtcgacctggaatgttctgtgtcacatcggccaccaactcctgcgcccgctgcacc
gcctgccccatcatcgacccggaggtggccaccaaactccagggtaaagctgagaaggat
accacctatgagccatctaaccccgggacccatctaaactgcagcaccaacccggaggac
agcgaggtgcctgccagtaccagcccctcctggatctcccccgcagactcccaggccagt
gaggggcgtggagggggtgccacccacgcccggtgggacgcgtccatctcaacaagtgcc
cccgtctccttctcctcctctggaagaaccatcctggtttcagggtctgtgctcttctgg
gcgattgtggtgctggtggtggtcatgggcaccagctccttcctcctgtaccaccggaag
gcctgctggaagtggattcggcagaagctgcacctgtgctacccagtccagaccttccag
ctcatgcccgagcctgtggattctaggccccagaggacccacacagagtggaaggggagt
gtgctggtagcccagccctgcacagaagttctggggttaatgagccccccatctgtggag
accagccccaacatgggggcagcctgcctggagagcctgccgctggtgggtgccagtcca
gctgggagcccctcgtcccccagggacctccctgagccccgggtgaccacggagcatacc
aacaacaggatcgagaaaatctatatcatgaaggccgacacagtgatcgtggggaccgtg
aagaccgaggtgcccgagggccggggcctggcggggccggcggagcccgagctcgaggag
gatctggaagtggaccatgccccccactacccggagcaggagacagaaccacctctgggc
agctgcagggatgtcatgttctcagtggaggaggaagggaaggcggaccccttgcctacg
accgcctctgggaagtga

DBGET integrated database retrieval system