KEGG   Molossus molossus (Pallas's mastiff bat): 118641415
Entry
118641415         CDS       T07221                                 
Symbol
ITGAX
Name
(RefSeq) integrin alpha-X isoform X1
  KO
K06462  integrin alpha X
Organism
mmf  Molossus molossus (Pallas's mastiff bat)
Pathway
mmf04610  Complement and coagulation cascades
mmf04810  Regulation of actin cytoskeleton
mmf05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:mmf00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    118641415 (ITGAX)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    118641415 (ITGAX)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    118641415 (ITGAX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmf04515]
    118641415 (ITGAX)
   04090 CD molecules [BR:mmf04090]
    118641415 (ITGAX)
Cell adhesion molecules [BR:mmf04515]
 Integrins
  Integrin alpha subunits
   118641415 (ITGAX)
CD molecules [BR:mmf04090]
 Proteins
  118641415 (ITGAX)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 FG-GAP_3 Integrin_alpha VWA_CoxE FG-GAP_2
Other DBs
NCBI-GeneID: 118641415
NCBI-ProteinID: XP_036134508
LinkDB
Position
Unknown
AA seq 1166 aa
MSDLTVMTRTRRTPLLLLMTLASCLCFNLDTDKPTIFPMDSAGFGHSVAQYANSWVVVGA
PQEITAANQTGGLYRCDYSLGTCEPIPLQVPPEAVNMSLGLSLTAATKPSQLLACGPTVH
HACKENMHLTGFCFLWVSPSWQARRLPDALQECPRQEQDIVFLIDGSGSISHSDFIQMLN
FVKAVMSQFQGPSTQFSLMQFSNTFVVHFTFKDFAHSSNPVGLLDSVKQLRGYTHTATAI
QIVTVRLFSAQYGARKDASKILIVITDGEKTGDPLSYRAVTPLADAAGIIRYAVGVGSAF
QKAHSWKELQDIASRPSHEHIFTVENFDALRDIQNQLKEKIFAIEGTQTTSSSSFELEMS
QEGFSAVSTPDGPVLGAVGSFSWSGGAFIYPPNMNPTFINMSQENVDMRDSYLGYSTELA
LWKGVQSLVLGAPRHEHTGKVVIFTQASGQWRPKAQVLGTQIGSYFGASLCSVDVDRDGS
SDLVLIGAPHYYELTRGGRVSVCPLPQGRSRWQCEAILRGEQGHPWGRFGTALTVLGDVN
GDKLTDVAIGAPGEQENQGAVYLFHGTSGRGISPSHSQRIAGSQFPPGLQHFGQSLSGGQ
DLTMDGLADLAVGAQGHALLLRTRPVLRVWVTIRPTLTEIGRSVFECREHTSSVQELGAA
DICLQVHESSRNRLGNLESSVTFDLTLDPGRLNPRAIFKETNTRHLTRDRLLGLGQHCEN
VKLLLPACVEDSVTPIILSLNFSLVGKPISSFGNLQPMLATDALRYFTASIPFEKNCGAD
HVCQDDLGISFHFSGLKTLVVGSNLELHMEVKVWNDGEDSYGTTVTFSYPPGLSYRRVAV
SQSQLLSRSLHLTCDSASAESQDTWSTRCSIKHIIFREGAQITFVATFDVSPKAMLGNQL
LLRANVSSENNTPKSSKTTFKLELPVKYAVYTVISSHEESTKYLNFSASEEGSSLVQHRY
QANNLGQRDLPVSISFLVPVELNQVSVWTGLEISHPQNSSIHCSSERIAPTESNFRTFIQ
KNSVLNCSIADCQRFRCDIPSFGIQEELDFILKGNLSFRWVSQTLQKKVLVVTVAEITFS
RSVYSQLPGQEAFLRAQMEMVVEENEVYDPVPLIAGSSVGGLLLLALITAVLYKVGFFKR
QYKDMMDEANGQTAPENETSDPQAGQ
NT seq 3501 nt   +upstreamnt  +downstreamnt
atgtctgacctcacagtcatgaccaggaccaggaggacaccccttctcctactgatgacc
ttggcttcctgtctctgcttcaacttggacacggacaagccaacaatcttccccatggat
agtgctgggtttggacacagtgtggcccagtacgccaactcctgggtggtggttggagcc
ccccaggagataacggctgccaaccaaacaggcggtctctaccggtgtgactacagcctg
ggcacctgtgagcccatccccctgcaggtgcccccagaggctgtgaacatgtccctgggc
ctatccctgacagctgccaccaaaccatctcagctgctggcctgcggccccactgtgcac
cacgcatgcaaggagaacatgcacttgaccgggttctgcttcctgtgggtttccccttcc
tggcaggcccggaggctcccagatgccctgcaggagtgcccgaggcaggagcaggacatc
gtcttcctgattgacggctcaggcagcatctcccacagcgattttatccagatgctgaac
ttcgtgaaggctgtgatgagccagttccagggacccagcacccagttctccctgatgcag
ttctccaacaccttcgtggttcacttcaccttcaaagacttcgcgcacagctcaaaccca
gtgggcctcctggattctgtgaaacagctgagagggtacactcatacagcgacagccatc
cagattgtcacggtccgcctgttcagtgcccaatatggggcccgaaaggacgcctccaag
atcctcatcgtcatcaccgatggagagaagacaggcgaccccctgagttaccgggctgtc
acccccttggccgatgcagcgggcatcatccgctatgccgtcggggtgggatcggctttt
caaaaggcacattcctggaaagaattgcaggacatcgcatcgagaccctcccatgagcat
atatttacagtggagaacttcgatgctttgagagacattcagaaccagctgaaggagaag
atctttgccattgagggaacacagaccacaagcagcagctccttcgaattggagatgtcc
caggagggcttcagcgctgtgtccacgcctgatggaccagttttgggggccgtggggagc
ttcagctggtctgggggtgccttcatatatcccccaaatatgaaccccaccttcatcaac
atgtctcaggagaatgtggacatgagggactcctacctgggttactccaccgagctggcc
ctttggaagggggtgcagagcctggtcctgggggccccccgccatgagcacaccgggaag
gttgtcatcttcacgcaggcttctgggcaatggaggccgaaggctcaagtcctagggacc
cagattggctcctacttcggggcctccctctgctcggtggacgtggacagagacggcagc
tccgacctggtcctcatcggggctccccattactacgagctgacccgggggggccgggtg
tctgtgtgccccttgccccaggggaggtctaggtggcagtgtgaggccattctccgtggg
gagcaaggccacccctgggggcgctttgggacagccctgaccgtgctgggggacgtgaat
ggggacaagctgacggacgtggccatcggggcccctggagaacaggagaaccagggtgct
gtctacctgtttcatggaacctcagggcggggcatcagcccctcccacagccagaggatt
gcaggctcccagttcccccccgggctccagcattttgggcagtcgctgagtgggggtcag
gacctcaccatggacggacttgcggacctggctgtgggggcccaggggcacgcgctgctg
ctcaggaccagacccgtgctcagggtgtgggtgactatccgcccaacgctcacagagatt
ggcaggtctgtgttcgagtgtcgggagcacacgtcctccgtccaggaactgggtgctgcc
gatatctgtcttcaggttcatgaaagttccaggaatcggctgggcaacctcgaaagctct
gtgacctttgacttgacccttgaccctggccgcctgaatccccgcgctatcttcaaggag
acaaacactcggcacctgactcgtgacagacttcttgggctaggacagcactgtgagaat
gtgaagttgctcctcccggcttgtgtggaggactcggtgacccctatcatcttgagtctc
aatttctccctggtgggcaagcccatctcttcttttggaaacctccagcccatgctggcg
acagatgctctcagatacttcacagcctctatccccttcgagaagaactgtggagccgac
catgtctgccaggatgaccttggcatctcctttcacttctcaggcttgaagaccctggtg
gtggggagtaacctggagctgcacatggaagtgaaagtgtggaatgacggcgaggactcc
tacggaaccacggtcaccttctcctacccacctgggctgtcttatcggcgtgtggcagtg
agccagagccagctgctgtcacggtccctgcacctgacctgtgacagcgcctcagctgag
agccaggacacctggagcacccgctgcagcatcaaacatatcatcttccgagagggtgcc
cagatcaccttcgtggccacctttgacgtctcccccaaggccatgctgggaaaccagctg
cttctgagggctaatgtgagcagtgagaataacacccccaagagcagcaagaccaccttc
aagctggagctcccagtgaagtatgctgtctacactgtgatcagcagccatgaggaatcc
accaagtacctcaacttctcggcctccgaggagggaagcagcctggtccagcacagatac
caggcgaacaacctggggcagagggacctgcctgtcagcatcagcttcttggtgcctgtg
gagctgaaccaggtgtctgtgtggacagggctggagatctcccacccccagaactcatct
attcattgctcttcagagaggatagcgcccacagagtccaacttccggaccttcatccag
aagaattctgttctgaactgctccattgctgactgccagaggttccgctgtgacatcccc
tcctttggcatccaggaggaacttgacttcatcctgaagggcaacctcagcttccgctgg
gtcagccagacactgcagaagaaggtgctggtcgtgactgtggctgaaatcacgttcagc
agatctgtgtattcccagcttccgggacaggaggcgtttttgagagctcagatggagatg
gtggtggaagagaacgaggtctacgatcccgtccccctcattgcgggcagctctgtgggc
gggctgttgctgctggcgctcatcacagccgtcctgtacaaggttggcttcttcaaacgt
cagtacaaggacatgatggacgaagcaaatggacaaactgccccagaaaatgaaacatca
gacccccaggctggtcaataa

DBGET integrated database retrieval system