KEGG   Mus musculus (house mouse): 100042295
Entry
100042295         CDS       T01002                                 
Symbol
Gm3776
Name
(RefSeq) predicted gene 3776
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu01524  Platinum drug resistance
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis - DNA adducts
mmu05207  Chemical carcinogenesis - receptor activation
mmu05208  Chemical carcinogenesis - reactive oxygen species
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100042295 (Gm3776)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100042295 (Gm3776)
   00982 Drug metabolism - cytochrome P450
    100042295 (Gm3776)
   00983 Drug metabolism - other enzymes
    100042295 (Gm3776)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100042295 (Gm3776)
   05204 Chemical carcinogenesis - DNA adducts
    100042295 (Gm3776)
   05207 Chemical carcinogenesis - receptor activation
    100042295 (Gm3776)
   05208 Chemical carcinogenesis - reactive oxygen species
    100042295 (Gm3776)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100042295 (Gm3776)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100042295 (Gm3776)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100042295 (Gm3776)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    100042295 (Gm3776)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100042295 (Gm3776)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   100042295 (Gm3776)
SSDB
Motif
Pfam: GST_N GST_C GST_C_3 GST_N_3
Other DBs
NCBI-GeneID: 100042295
NCBI-ProteinID: NP_001230021
MGI: 3826440
Ensembl: ENSMUSG00000111709
UniProt: Q6P8Q0
LinkDB
Position
9:78164411..78176448
AA seq 223 aa
MAGKPVLHHFNARGRMECIRWLLAAAGVEFEEKFIQSPEDLEKLKKDGNLMFDQVPMVEI
DGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYSEGILDLTEMIGQLVLCPPDQREAK
TALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLEVLLYVEEFDASLLTPFPL
LKAFKSRISSLPNVKKFLQPGSQRKPPMDAKQIQEARKAFKIQ
NT seq 672 nt   +upstreamnt  +downstreamnt
atggccgggaagcccgtgcttcaccacttcaatgcccggggcagaatggagtgcatcagg
tggctcctggctgcagcaggggtggagtttgaagagaagtttatacagagtccggaagat
ttggaaaagctaaaaaaagatgggaatttgatgtttgaccaagtgcccatggtggagatt
gatgggatgaagctggcgcagaccagagccattctcaactacatcgccaccaaatatgac
ctctatgggaaggacatgaaggagagagccctgattgacatgtattcagaaggtatttta
gatctgactgaaatgattgggcaattggtattatgtcccccagaccaaagagaagccaag
actgccttggcaaaagataggaccaaaaaccgttacttgcctgcctttgaaaaggtgttg
aagagccatggacaagactaccttgtgggcaacaggctgaccagggtggacatccaccta
ctggaagttctcctctatgttgaagagtttgatgccagccttctgacccctttccctctg
ctgaaggccttcaagagcagaatcagcagcctccccaatgtgaagaagtttctacagcct
ggcagccagagaaagcctcccatggatgcaaaacaaattcaagaagcaaggaaggctttc
aagattcagtga

KEGG   Mus musculus (house mouse): 100042314
Entry
100042314         CDS       T01002                                 
Symbol
Gsta5, Gm10639
Name
(RefSeq) glutathione S-transferase alpha 5
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu01524  Platinum drug resistance
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis - DNA adducts
mmu05207  Chemical carcinogenesis - receptor activation
mmu05208  Chemical carcinogenesis - reactive oxygen species
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100042314 (Gsta5)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100042314 (Gsta5)
   00982 Drug metabolism - cytochrome P450
    100042314 (Gsta5)
   00983 Drug metabolism - other enzymes
    100042314 (Gsta5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100042314 (Gsta5)
   05204 Chemical carcinogenesis - DNA adducts
    100042314 (Gsta5)
   05207 Chemical carcinogenesis - receptor activation
    100042314 (Gsta5)
   05208 Chemical carcinogenesis - reactive oxygen species
    100042314 (Gsta5)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100042314 (Gsta5)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100042314 (Gsta5)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100042314 (Gsta5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    100042314 (Gsta5)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100042314 (Gsta5)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   100042314 (Gsta5)
SSDB
Motif
Pfam: GST_N GST_C GST_C_3 GST_N_3
Other DBs
NCBI-GeneID: 100042314
NCBI-ProteinID: NP_001116132
MGI: 3704339
Ensembl: ENSMUSG00000074179
UniProt: E9Q6L7
LinkDB
Position
9:78197210..78212807
AA seq 222 aa
MAGKPVLHHFNARGRMECIRWLLAAAGVEFEEKFIQSPEDLEKLKKDGNLMFDQVPMVEI
DGMKLVQTRAILNYIATKYDLYGKDMKERALIDMYSEGILDLTEMIGQLLICPPDQKEAK
TALAKDRTKNRYLPAFEKVLKGHGQDYLVGNRLTRVDVHLLELLLYVEEFDASLLTPFPL
LKAFKSRISSLPNVKKFLHPGSQRKPPLDAKQIEEARKIFKF
NT seq 669 nt   +upstreamnt  +downstreamnt
atggccgggaagcccgtgcttcaccacttcaatgcccggggcagaatggagtgcatcagg
tggctcctggctgcagcaggggtggagtttgaagagaagtttatacagagtccggaagat
ttggaaaagctaaaaaaagatgggaatttgatgtttgaccaagtgcccatggtggagatt
gatgggatgaagctggtgcagaccagagccattctcaactacatcgccaccaaatatgac
ctctatgggaaggacatgaaggagagagccctgattgacatgtattcagaaggtatttta
gatctgactgaaatgattgggcaattgttaatatgtcccccagaccaaaaagaagccaag
actgccttggcaaaagacaggaccaaaaaccgttacttgcctgcctttgaaaaggtgttg
aagggccatggacaagactaccttgtgggcaacaggctgaccagggtggacgtccacctg
ctggaacttctcctctatgttgaagagtttgatgccagccttctgactcctttccctctg
ctgaaggccttcaagagcagaatcagcagcctccccaatgtgaagaagttcctacatcct
ggcagccagagaaagcctcccttggatgcaaaacaaattgaagaagcaaggaagattttc
aagttttag

KEGG   Mus musculus (house mouse): 103140
Entry
103140            CDS       T01002                                 
Symbol
Gstt3, AI118089
Name
(RefSeq) glutathione S-transferase, theta 3
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu01524  Platinum drug resistance
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis - DNA adducts
mmu05207  Chemical carcinogenesis - receptor activation
mmu05208  Chemical carcinogenesis - reactive oxygen species
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    103140 (Gstt3)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    103140 (Gstt3)
   00982 Drug metabolism - cytochrome P450
    103140 (Gstt3)
   00983 Drug metabolism - other enzymes
    103140 (Gstt3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103140 (Gstt3)
   05204 Chemical carcinogenesis - DNA adducts
    103140 (Gstt3)
   05207 Chemical carcinogenesis - receptor activation
    103140 (Gstt3)
   05208 Chemical carcinogenesis - reactive oxygen species
    103140 (Gstt3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103140 (Gstt3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103140 (Gstt3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103140 (Gstt3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    103140 (Gstt3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     103140 (Gstt3)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   103140 (Gstt3)
SSDB
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_N_4 GST_C_2 Glutaredoxin
Other DBs
NCBI-GeneID: 103140
NCBI-ProteinID: NP_598755
MGI: 2143526
Ensembl: ENSMUSG00000001665
UniProt: Q99L20
LinkDB
Position
10:complement(75609951..75617256)
AA seq 241 aa
MGLELYLDLMSQPCRAVYIFAKKNGIPFQLRTIELLKGQQYTDSFAQVNPLRKVPALKDG
DFVLAESVAILLYLSRKYKAPDHWYPQDLQTRARVDEYLAWQHTALRSCCTRAMWQKMMF
PVFLGQPVPPEMLASTLAELDGCLQVLEDKFLRNQAFLTGSHISVADLVAITELMHPVSA
GCKIFESRPKLAAWRQRVEAEVGESLFQEAHEVVLKAKDMPPLMDPALKEKLKLSVQCLL
H
NT seq 726 nt   +upstreamnt  +downstreamnt
atgggtctggagctctacctggacctgatgtcccaaccctgccgtgctgtctacatcttc
gccaagaagaacggcatccccttccagctgcgtaccatagagctgcttaaaggtcagcag
tacacagattccttcgcccaggtgaaccctttgaggaaggtgccagctttgaaggatggg
gacttcgtcttggcagagagtgtggccatcttgttgtatctgagtagaaagtacaaggcc
cccgaccactggtaccctcaggatctgcagactcgagctcgtgtagacgagtacctggca
tggcagcacacagccctgcggagttgttgcaccagggccatgtggcagaagatgatgttc
cctgtgttcctgggacagcccgtacctcctgagatgctggcatccaccttggctgaactg
gatgggtgcctgcaggtgctagaggacaagttcctgcggaaccaggccttccttacagga
tcccatatttctgtggctgacttggtggccatcacagagctgatgcatcctgtcagtgct
ggctgcaaaatctttgagagccgacccaaactggctgcctggcgtcagagagtagaagcc
gaagtgggggagagcctcttccaggaggcccatgaagttgtcctgaaggccaaggatatg
cctcccttgatggaccctgccttgaaagagaagctgaagctctctgtgcagtgtttgtta
cactga

KEGG   Mus musculus (house mouse): 14857
Entry
14857             CDS       T01002                                 
Symbol
Gsta1, Gst2-1
Name
(RefSeq) glutathione S-transferase, alpha 1 (Ya)
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu01524  Platinum drug resistance
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis - DNA adducts
mmu05207  Chemical carcinogenesis - receptor activation
mmu05208  Chemical carcinogenesis - reactive oxygen species
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    14857 (Gsta1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    14857 (Gsta1)
   00982 Drug metabolism - cytochrome P450
    14857 (Gsta1)
   00983 Drug metabolism - other enzymes
    14857 (Gsta1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14857 (Gsta1)
   05204 Chemical carcinogenesis - DNA adducts
    14857 (Gsta1)
   05207 Chemical carcinogenesis - receptor activation
    14857 (Gsta1)
   05208 Chemical carcinogenesis - reactive oxygen species
    14857 (Gsta1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    14857 (Gsta1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    14857 (Gsta1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    14857 (Gsta1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    14857 (Gsta1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     14857 (Gsta1)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   14857 (Gsta1)
SSDB
Motif
Pfam: GST_N GST_C GST_C_3 GST_N_3
Other DBs
NCBI-GeneID: 14857
NCBI-ProteinID: NP_032207
MGI: 1095417
Ensembl: ENSMUSG00000074183
UniProt: P13745
Structure
LinkDB
Position
9:78137951..78149965
AA seq 223 aa
MAGKPVLHYFNARGRMECIRWLLAAAGVEFEEKFIQSPEDLEKLKKDGNLMFDQVPMVEI
DGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYSEGILDLTEMIGQLVLCPPDQREAK
TALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLEVLLYVEEFDASLLTPFPL
LKAFKSRISSLPNVKKFLQPGSQRKPPMDAKQIQEARKAFKIQ
NT seq 672 nt   +upstreamnt  +downstreamnt
atggccgggaagcccgtgcttcactacttcaatgcccggggcagaatggagtgcatcagg
tggctcctggctgcagcaggggtggagtttgaagagaagtttatacagagtccggaagat
ttggaaaagctaaaaaaagatgggaatttgatgtttgaccaagtgcccatggtggagatt
gatgggatgaagctggcgcagaccagagccattctcaactacatcgccaccaaatatgac
ctctatgggaaggacatgaaggagagagccctgattgacatgtattcagaaggtatttta
gatctgactgaaatgattgggcaattggtattatgtcccccagaccaaagagaagccaag
actgccttggcaaaagataggaccaaaaaccgttacttgcctgcctttgaaaaggtgttg
aagagccatggacaagactaccttgtgggcaacaggctgaccagggtggacatccaccta
ctggaagttctcctctatgttgaagagtttgatgccagccttctgacccctttccctctg
ctgaaggccttcaagagcagaatcagcagcctccccaatgtgaagaagttcctacagcct
ggcagccagagaaagcctcccatggatgcaaaacaaattcaagaagcaaggaaggctttc
aagattcagtga

KEGG   Mus musculus (house mouse): 14858
Entry
14858             CDS       T01002                                 
Symbol
Gsta2, Gst2-2, Gstc-2, Gstc2
Name
(RefSeq) glutathione S-transferase, alpha 2 (Yc2)
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu01524  Platinum drug resistance
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis - DNA adducts
mmu05207  Chemical carcinogenesis - receptor activation
mmu05208  Chemical carcinogenesis - reactive oxygen species
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    14858 (Gsta2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    14858 (Gsta2)
   00982 Drug metabolism - cytochrome P450
    14858 (Gsta2)
   00983 Drug metabolism - other enzymes
    14858 (Gsta2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14858 (Gsta2)
   05204 Chemical carcinogenesis - DNA adducts
    14858 (Gsta2)
   05207 Chemical carcinogenesis - receptor activation
    14858 (Gsta2)
   05208 Chemical carcinogenesis - reactive oxygen species
    14858 (Gsta2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    14858 (Gsta2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    14858 (Gsta2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    14858 (Gsta2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    14858 (Gsta2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     14858 (Gsta2)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   14858 (Gsta2)
SSDB
Motif
Pfam: GST_N GST_C GST_C_3 GST_N_3
Other DBs
NCBI-GeneID: 14858
NCBI-ProteinID: NP_032208
MGI: 95863
Ensembl: ENSMUSG00000057933
UniProt: P10648
Structure
LinkDB
Position
9:complement(78238300..78254474)
AA seq 222 aa
MAGKPVLHYFNARGRMECIRWLLAAAGVEFEEKFIQSPEDLEKLKKDGNLMFDQVPMVEI
DGMKLVQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIGQLVLCPPDQREAK
TALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDVHLLELLLYVEELDASLLTPFPL
LKAFKSRISSLPNVKKFLHPGSQRKPPLDAKQIEEARKVFKF
NT seq 669 nt   +upstreamnt  +downstreamnt
atggccgggaagcccgtgcttcactacttcaatgcccggggcagaatggagtgcatcagg
tggctcctggctgcagcaggggtggagtttgaagagaagtttatacagagtccggaagat
ttggaaaagctaaaaaaagatgggaatttgatgtttgaccaagtgcccatggtggagatt
gatgggatgaagctggtgcagaccagagccattctcaactacatcgccaccaaatatgac
ctctatgggaaggacatgaaggagagagccctgattgacatgtatacagaaggtatttta
gatctgactgaaatgattgggcaattggtattatgtcccccagaccaaagagaagccaag
actgccttggcaaaagacaggaccaaaaaccgttacttgcctgcctttgaaaaggtgttg
aagagccatggacaagactaccttgtgggcaacaggctgaccagggtggacgtccacctg
ctggaacttcttctctatgttgaagagcttgatgccagccttctgacccctttccctctg
ctgaaggccttcaagagcagaatcagcagcctccccaatgtgaagaagttcctacatcct
ggcagccagagaaagcctcccttggatgcaaaacaaattgaagaagcaaggaaggttttc
aagttttag

KEGG   Mus musculus (house mouse): 14859
Entry
14859             CDS       T01002                                 
Symbol
Gsta3, Gst2-3
Name
(RefSeq) glutathione S-transferase, alpha 3
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu01524  Platinum drug resistance
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis - DNA adducts
mmu05207  Chemical carcinogenesis - receptor activation
mmu05208  Chemical carcinogenesis - reactive oxygen species
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    14859 (Gsta3)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    14859 (Gsta3)
   00982 Drug metabolism - cytochrome P450
    14859 (Gsta3)
   00983 Drug metabolism - other enzymes
    14859 (Gsta3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14859 (Gsta3)
   05204 Chemical carcinogenesis - DNA adducts
    14859 (Gsta3)
   05207 Chemical carcinogenesis - receptor activation
    14859 (Gsta3)
   05208 Chemical carcinogenesis - reactive oxygen species
    14859 (Gsta3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    14859 (Gsta3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    14859 (Gsta3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    14859 (Gsta3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    14859 (Gsta3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     14859 (Gsta3)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   14859 (Gsta3)
SSDB
Motif
Pfam: GST_C GST_N GST_C_3 GST_N_3 GST_C_2
Other DBs
NCBI-GeneID: 14859
NCBI-ProteinID: NP_001070821
MGI: 95856
Ensembl: ENSMUSG00000025934
UniProt: P30115
LinkDB
Position
1:21310789..21335799
AA seq 221 aa
MAGKPVLHYFDGRGRMEPIRWLLAAAGVEFEEKFLKTRDDLARLRSDGSLMFQQVPMVEI
DGMKLVQTKAILNYIASKYNLYGKDMKERAIIDMYTEGVADLEIMILYYPHMPPEEKEAS
LAKIKEQTRNRYFPAFEKVLKSHGQDYLVGNRLSRADIALVELLYHVEELDPGVVDNFPL
LKALRSRVSNLPTVKKFLQPGSQRKPFDDAKCVESAKKIFS
NT seq 666 nt   +upstreamnt  +downstreamnt
atggcggggaagccagtccttcattactttgatggcaggggaagaatggagcctatccgg
tggctcttggctgcagctggtgtggagtttgaagaaaaatttctgaaaactcgggatgac
ctggcaaggttacgaagtgatgggagtctgatgttccagcaagtgcccatggtagagatc
gacgggatgaaactggtgcagaccaaagccattctcaactacattgcctccaaatacaac
ctctatgggaaggacatgaaggagagagccatcattgacatgtacacagaaggagtggcg
gatctggagataatgattctctattacccccacatgccccctgaggagaaagaggcaagc
cttgccaagatcaaggaacaaaccaggaaccgttacttccctgcctttgaaaaggtgttg
aagagccatggacaagattatctcgttggcaacaggctgagcagggctgatattgccctg
gttgaactcctctaccatgtggaagagctggacccgggcgttgtggacaacttccctctc
ctgaaagcgctgagaagcagagtcagcaacctccccacagtgaagaagtttcttcaacct
ggcagccagaggaagccttttgatgacgcaaaatgtgttgagtcagcaaagaagattttc
agttaa

KEGG   Mus musculus (house mouse): 14860
Entry
14860             CDS       T01002                                 
Symbol
Gsta4, GST5.7, mGsta4
Name
(RefSeq) glutathione S-transferase, alpha 4
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu01524  Platinum drug resistance
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis - DNA adducts
mmu05207  Chemical carcinogenesis - receptor activation
mmu05208  Chemical carcinogenesis - reactive oxygen species
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    14860 (Gsta4)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    14860 (Gsta4)
   00982 Drug metabolism - cytochrome P450
    14860 (Gsta4)
   00983 Drug metabolism - other enzymes
    14860 (Gsta4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14860 (Gsta4)
   05204 Chemical carcinogenesis - DNA adducts
    14860 (Gsta4)
   05207 Chemical carcinogenesis - receptor activation
    14860 (Gsta4)
   05208 Chemical carcinogenesis - reactive oxygen species
    14860 (Gsta4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    14860 (Gsta4)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    14860 (Gsta4)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    14860 (Gsta4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    14860 (Gsta4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     14860 (Gsta4)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   14860 (Gsta4)
SSDB
Motif
Pfam: GST_C_3 GST_C GST_N GST_N_3 GST_C_2 GST_N_2
Other DBs
NCBI-GeneID: 14860
NCBI-ProteinID: NP_034487
MGI: 1309515
Ensembl: ENSMUSG00000032348
UniProt: P24472
Structure
LinkDB
Position
9:78099248..78116631
AA seq 222 aa
MAAKPKLYYFNGRGRMESIRWLLAAAGVEFEEEFLETREQYEKMQKDGHLLFGQVPLVEI
DGMMLTQTRAILSYLAAKYNLYGKDLKERVRIDMYADGTQDLMMMIAVAPFKTPKEKEES
YDLILSRAKTRYFPVFEKILKDHGEAFLVGNQLSWADIQLLEAILMVEELSAPVLSDFPL
LQAFKTRISNIPTIKKFLQPGSQRKPPPDGPYVEVVRTVLKF
NT seq 669 nt   +upstreamnt  +downstreamnt
atggcagccaaacctaagctctactactttaatggcaggggacggatggagtcgatccgc
tggctgctggctgcggctggagtggagtttgaggaagaatttcttgagacaagggaacag
tatgagaagatgcaaaaggatggacacctgcttttcggccaagtacccttggttgaaatc
gatgggatgatgctgacacagaccagggccatcctcagctacctcgctgccaagtacaac
ttgtatgggaaggacctgaaggagagagtcaggattgacatgtatgcagatggcacccag
gacctgatgatgatgattgccgtggctccatttaaaacccccaaggaaaaagaggagagc
tatgatttgatactgtcaagagctaaaacccgttacttcccagtgtttgaaaagatttta
aaagaccacggagaggcttttctcgttggcaaccagctcagttgggcagacatccagctc
ctagaagccattttgatggtggaagaactcagtgcccctgtactgtccgacttccctctg
ctgcaggcatttaagacaagaatcagcaacattcctacaattaagaagttcctgcaaccc
ggaagtcagaggaagcctcctccagatggcccctatgttgaggtggtcaggactgtcctg
aagttctag

KEGG   Mus musculus (house mouse): 14862
Entry
14862             CDS       T01002                                 
Symbol
Gstm1, Gstb-1, Gstb1
Name
(RefSeq) glutathione S-transferase, mu 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu01524  Platinum drug resistance
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis - DNA adducts
mmu05207  Chemical carcinogenesis - receptor activation
mmu05208  Chemical carcinogenesis - reactive oxygen species
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    14862 (Gstm1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    14862 (Gstm1)
   00982 Drug metabolism - cytochrome P450
    14862 (Gstm1)
   00983 Drug metabolism - other enzymes
    14862 (Gstm1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14862 (Gstm1)
   05204 Chemical carcinogenesis - DNA adducts
    14862 (Gstm1)
   05207 Chemical carcinogenesis - receptor activation
    14862 (Gstm1)
   05208 Chemical carcinogenesis - reactive oxygen species
    14862 (Gstm1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    14862 (Gstm1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    14862 (Gstm1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    14862 (Gstm1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    14862 (Gstm1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     14862 (Gstm1)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   14862 (Gstm1)
SSDB
Motif
Pfam: GST_N GST_C_3 GST_C GST_C_2 GST_C_6 GST_N_3 GST_N_4
Other DBs
NCBI-GeneID: 14862
NCBI-ProteinID: NP_034488
MGI: 95860
Ensembl: ENSMUSG00000058135
UniProt: P10649
LinkDB
Position
3:complement(107919566..107925289)
AA seq 218 aa
MPMILGYWNVRGLTHPIRMLLEYTDSSYDEKRYTMGDAPDFDRSQWLNEKFKLGLDFPNL
PYLIDGSHKITQSNAILRYLARKHHLDGETEEERIRADIVENQVMDTRMQLIMLCYNPDF
EKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPN
LRDFLARFEGLKKISAYMKSSRYIATPIFSKMAHWSNK
NT seq 657 nt   +upstreamnt  +downstreamnt
atgcctatgatactgggatactggaacgtccgcggactgacacacccgatccgcatgctc
ctggaatacacagactcaagctatgatgagaagagatacaccatgggtgacgctcccgac
tttgacagaagccagtggctgaatgagaagttcaagctgggcctggactttcccaatctg
ccttacttgatcgatggatcacacaagatcacccagagcaatgccatcctgcgctacctt
gcccgaaagcaccacctggatggagagacagaggaggagaggatccgtgcagacattgtg
gagaaccaggtcatggacacccgcatgcagctcatcatgctctgttacaaccctgacttt
gagaagcagaagccagagttcttgaagaccatccctgagaaaatgaagctctactctgag
ttcctgggcaagaggccatggtttgcaggggacaaggtcacctatgtggatttccttgct
tatgacattcttgaccagtaccgtatgtttgagcccaagtgcctggacgccttcccaaac
ctgagggacttcctggcccgcttcgagggcctcaagaagatctctgcctacatgaagagt
agccgctacatcgcaacacctatattttcaaagatggcccactggagtaacaagtag

KEGG   Mus musculus (house mouse): 14863
Entry
14863             CDS       T01002                                 
Symbol
Gstm2, Gstb-2, Gstb2
Name
(RefSeq) glutathione S-transferase, mu 2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu01524  Platinum drug resistance
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis - DNA adducts
mmu05207  Chemical carcinogenesis - receptor activation
mmu05208  Chemical carcinogenesis - reactive oxygen species
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    14863 (Gstm2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    14863 (Gstm2)
   00982 Drug metabolism - cytochrome P450
    14863 (Gstm2)
   00983 Drug metabolism - other enzymes
    14863 (Gstm2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14863 (Gstm2)
   05204 Chemical carcinogenesis - DNA adducts
    14863 (Gstm2)
   05207 Chemical carcinogenesis - receptor activation
    14863 (Gstm2)
   05208 Chemical carcinogenesis - reactive oxygen species
    14863 (Gstm2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    14863 (Gstm2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    14863 (Gstm2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    14863 (Gstm2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    14863 (Gstm2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     14863 (Gstm2)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   14863 (Gstm2)
SSDB
Motif
Pfam: GST_N GST_C GST_C_3 GST_C_6 GST_N_3 GST_C_2 Tom37 GST_N_2
Other DBs
NCBI-GeneID: 14863
NCBI-ProteinID: NP_032209
MGI: 95861
Ensembl: ENSMUSG00000040562
UniProt: P15626
LinkDB
Position
3:complement(107889018..107893736)
AA seq 218 aa
MPMTLGYWDIRGLAHAIRLLLEYTDTSYEDKKYTMGDAPDYDRSQWLSEKFKLGLDFPNL
PYLIDGSHKITQSNAILRYLARKHNLCGETEEERIRVDILENQAMDTRIQLAMVCYSPDF
EKKKPEYLEGLPEKMKLYSEFLGKQPWFAGNKVTYVDFLVYDVLDQHRIFEPKCLDAFPN
LKDFMGRFEGLKKISDYMKSSRFLSKPIFAKMAFWNPK
NT seq 657 nt   +upstreamnt  +downstreamnt
atgcctatgacactaggttactgggacatccgtgggctggctcacgccatccgcctgctc
ctggaatacacagacacaagctatgaggacaagaaatacaccatgggggacgctcctgac
tatgaccgaagccagtggctgagtgagaagttcaagctgggcctggactttcccaatctg
ccctacttgattgatggatcacacaagatcacccagagcaatgccatcctgcgctacctt
gcccgaaagcacaacctgtgtggagagacagaggaggagaggattcgtgtggacattttg
gagaaccaggctatggacacccgcatacagttggccatggtttgctacagccctgacttt
gagaaaaagaagccagagtacttagagggtctccctgagaagatgaagctctactctgag
tttctgggcaagcagccatggtttgcagggaacaaggtcacctatgtggattttcttgtt
tatgatgtccttgatcaacaccgaatatttgagcccaagtgcctggatgccttcccaaac
ctgaaggacttcatgggtcgctttgagggcctgaagaagatatctgactacatgaagagc
agccgcttcctctccaagccaatctttgcaaagatggccttttggaacccaaagtag

KEGG   Mus musculus (house mouse): 14864
Entry
14864             CDS       T01002                                 
Symbol
Gstm3, Fsc2, mGSTM5
Name
(RefSeq) glutathione S-transferase, mu 3
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu01524  Platinum drug resistance
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis - DNA adducts
mmu05207  Chemical carcinogenesis - receptor activation
mmu05208  Chemical carcinogenesis - reactive oxygen species
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    14864 (Gstm3)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    14864 (Gstm3)
   00982 Drug metabolism - cytochrome P450
    14864 (Gstm3)
   00983 Drug metabolism - other enzymes
    14864 (Gstm3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14864 (Gstm3)
   05204 Chemical carcinogenesis - DNA adducts
    14864 (Gstm3)
   05207 Chemical carcinogenesis - receptor activation
    14864 (Gstm3)
   05208 Chemical carcinogenesis - reactive oxygen species
    14864 (Gstm3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    14864 (Gstm3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    14864 (Gstm3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    14864 (Gstm3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    14864 (Gstm3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     14864 (Gstm3)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   14864 (Gstm3)
SSDB
Motif
Pfam: GST_N GST_C GST_C_3 GST_C_2 GST_C_6 GST_N_3
Other DBs
NCBI-GeneID: 14864
NCBI-ProteinID: NP_034489
MGI: 106026
Ensembl: ENSMUSG00000004038
UniProt: P19639
LinkDB
Position
3:complement(107871012..107876490)
AA seq 218 aa
MPMTLGYWNTRGLTHSIRLLLEYTDSSYEEKRYVMGDAPNFDRSQWLSEKFNLGLDFPNL
PYLIDGSHKVTQSNAILRYLGRKHNLCGETEEERIRVDTLENQVMDTRIQLMIVCCSPDF
EKQKPEFLKAIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPN
LRDFLARFEGLKKISAYMKSSRFLPRPVFTKIAQWGTD
NT seq 657 nt   +upstreamnt  +downstreamnt
atgcctatgacactgggctattggaacacccgcggactgactcactccatccgcttgctc
ctggaatacacagattcaagctatgaggagaagagatatgtcatgggggatgcccccaac
tttgaccgaagccagtggctgagtgagaaattcaatcttggcctggattttcccaatctg
ccctacttaattgatgggtcacacaaggtcacccagagcaatgccatcctgcgctacctt
ggccggaagcacaacctgtgtggagagacagaggaggagaggatccgtgtggatactttg
gagaaccaagttatggacacccgcatacagctcatgatagtctgctgcagtcccgatttt
gagaagcagaagccagagttcttgaaggccatccctgagaaaatgaagctctactctgag
ttcctgggcaagaggccatggtttgcaggggacaaggtcacctatgtggatttccttgct
tatgacattcttgaccagtatcgtatgtttgagcccaagtgcctggacgccttcccaaac
ctgagggacttcctggcccgcttcgagggcctcaagaagatctctgcctacatgaagagt
agccgcttcctcccaagacctgtgtttactaagatagcccagtggggcactgattag

KEGG   Mus musculus (house mouse): 14865
Entry
14865             CDS       T01002                                 
Symbol
Gstm4, 1110004G14Rik, GSTM4-4, GSTM7-7, Gstb-4, Gstb4
Name
(RefSeq) glutathione S-transferase, mu 4
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu01524  Platinum drug resistance
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis - DNA adducts
mmu05207  Chemical carcinogenesis - receptor activation
mmu05208  Chemical carcinogenesis - reactive oxygen species
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    14865 (Gstm4)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    14865 (Gstm4)
   00982 Drug metabolism - cytochrome P450
    14865 (Gstm4)
   00983 Drug metabolism - other enzymes
    14865 (Gstm4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14865 (Gstm4)
   05204 Chemical carcinogenesis - DNA adducts
    14865 (Gstm4)
   05207 Chemical carcinogenesis - receptor activation
    14865 (Gstm4)
   05208 Chemical carcinogenesis - reactive oxygen species
    14865 (Gstm4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    14865 (Gstm4)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    14865 (Gstm4)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    14865 (Gstm4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    14865 (Gstm4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     14865 (Gstm4)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   14865 (Gstm4)
SSDB
Motif
Pfam: GST_N GST_C_3 GST_C GST_C_6 GST_N_3 GST_C_2 GST_N_2
Other DBs
NCBI-GeneID: 14865
NCBI-ProteinID: NP_081040
MGI: 95862
Ensembl: ENSMUSG00000027890
UniProt: Q8R5I6
LinkDB
Position
3:complement(107937887..107952495)
AA seq 218 aa
MPMTLGYWDIRGLAHAIRLLLEYTGSSYEEKRYTMGDAPDYDRSQWLSEKFKLGLDFPNL
PYLIDGSHKITQSNAILRYIARKHNLCGETEEEKIRVDILENQAMDVSNQLARVCYSPDF
EKLKVEYLEQLPGMVKLFSQFLGQRTWFVGEKITFVDFLAYDILDLHLIFEPTCLDAFPN
LKDFVARFEVLKRISAYMKTSRFLRTPLYTKVATWGNK
NT seq 657 nt   +upstreamnt  +downstreamnt
atgcctatgacactgggttactgggacatccgtgggctagctcacgctattcggctgctc
ctagaatacacaggctcaagctatgaagagaagagatacaccatgggagacgctcctgac
tatgaccgaagccagtggctgagtgagaagttcaaattgggcctggactttcccaatttg
ccttacttgattgatgggtcacacaagatcacgcagagcaatgccatcctgcgctacatt
gcccgcaagcacaacctgtgtggggagacagaggaagagaagattcgcgtggacattttg
gagaaccaggctatggatgtctccaatcagctggctcgagtctgttacagcccagacttt
gagaaactgaaggtggaatacttggagcagctccctggaatggtgaagctcttctcacag
ttcctgggccagcggacatggtttgttggtgaaaagattacttttgtagatttcctggct
tacgatatcctggacctgcaccttatattcgaacccacgtgcctggacgccttcccaaac
ctgaaggactttgtggcccgctttgaggtactgaagaggatctctgcttacatgaagacc
agccgcttcctccgaacacccctatatacaaaggtggccacttggggcaataagtag

KEGG   Mus musculus (house mouse): 14866
Entry
14866             CDS       T01002                                 
Symbol
Gstm5
Name
(RefSeq) glutathione S-transferase, mu 5
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu01524  Platinum drug resistance
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis - DNA adducts
mmu05207  Chemical carcinogenesis - receptor activation
mmu05208  Chemical carcinogenesis - reactive oxygen species
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    14866 (Gstm5)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    14866 (Gstm5)
   00982 Drug metabolism - cytochrome P450
    14866 (Gstm5)
   00983 Drug metabolism - other enzymes
    14866 (Gstm5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14866 (Gstm5)
   05204 Chemical carcinogenesis - DNA adducts
    14866 (Gstm5)
   05207 Chemical carcinogenesis - receptor activation
    14866 (Gstm5)
   05208 Chemical carcinogenesis - reactive oxygen species
    14866 (Gstm5)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    14866 (Gstm5)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    14866 (Gstm5)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    14866 (Gstm5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    14866 (Gstm5)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     14866 (Gstm5)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   14866 (Gstm5)
SSDB
Motif
Pfam: GST_N GST_C GST_C_3 GST_N_3 GST_C_6 GST_C_2
Other DBs
NCBI-GeneID: 14866
NCBI-ProteinID: NP_034490
MGI: 1309466
Ensembl: ENSMUSG00000004032
UniProt: P48774
LinkDB
Position
3:107803170..107806001
AA seq 224 aa
MSSKSMVLGYWDIRGLAHAIRMLLEFTDTSYEEKRYICGEAPDYDRSQWLDVKFKLDLDF
PNLPYLMDGKNKITQSNAILRYIARKHNMCGDTEEEKIRVDIMENQIMDFRMQLVRLCYN
SNHENLKPQYLEQLPAQLKQFSLFLGKFTWFAGEKLTFVDFLTYDVLDQNRIFEPKCLDE
FPNLKAFMCRFEALEKIAAFLQSDRFFKMPINNKMAKWGNKCLC
NT seq 675 nt   +upstreamnt  +downstreamnt
atgtcatccaagtctatggttctgggttactgggatatccgcgggctggctcatgctatc
cgcatgcttctggagtttactgataccagctatgaggagaaacggtacatctgtggggaa
gctcctgactatgatagaagccaatggctggacgtgaaattcaagctagatctggacttt
cctaacctgccctacctcatggacgggaagaacaagatcacccagagtaacgccatcctg
agatacatcgcacgcaagcacaacatgtgtggtgacactgaagaagaaaagatacgagta
gacatcatggagaaccagatcatggacttccgcatgcagctggttcgcctctgctacaat
tctaaccacgaaaacctgaagcctcagtacttggaacagctacctgcacagctgaaacaa
ttctcattgttcctggggaaattcacatggtttgcaggagaaaagctgacctttgtggat
tttctcacctatgatgtcttggatcagaaccgtatatttgagcccaagtgtctggatgag
ttcccaaacctgaaggctttcatgtgccgttttgaggctttggagaagattgctgcattc
ctgcagtctgaccgcttcttcaagatgccaatcaataacaagatggccaagtggggtaac
aagtgcttatgctga

KEGG   Mus musculus (house mouse): 14867
Entry
14867             CDS       T01002                                 
Symbol
Gstm6
Name
(RefSeq) glutathione S-transferase, mu 6
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu01524  Platinum drug resistance
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis - DNA adducts
mmu05207  Chemical carcinogenesis - receptor activation
mmu05208  Chemical carcinogenesis - reactive oxygen species
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    14867 (Gstm6)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    14867 (Gstm6)
   00982 Drug metabolism - cytochrome P450
    14867 (Gstm6)
   00983 Drug metabolism - other enzymes
    14867 (Gstm6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14867 (Gstm6)
   05204 Chemical carcinogenesis - DNA adducts
    14867 (Gstm6)
   05207 Chemical carcinogenesis - receptor activation
    14867 (Gstm6)
   05208 Chemical carcinogenesis - reactive oxygen species
    14867 (Gstm6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    14867 (Gstm6)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    14867 (Gstm6)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    14867 (Gstm6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    14867 (Gstm6)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     14867 (Gstm6)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   14867 (Gstm6)
SSDB
Motif
Pfam: GST_N GST_C GST_C_3 GST_C_6 GST_C_2 GST_N_3
Other DBs
NCBI-GeneID: 14867
NCBI-ProteinID: NP_032210
MGI: 1309467
Ensembl: ENSMUSG00000068762
UniProt: O35660
LinkDB
Position
3:complement(107846163..107860957)
AA seq 218 aa
MPVTLGYWDIRGLGHAIRLLLEYTETGYEEKRYAMGDAPDYDRSQWLNDKFKLDLDFPNL
PYLIDGSHKVTQSNAILRYLGRKHNLCGETEEERIRVDILEKQVMDTRIQMGMLCYSADF
EKRKPEFLKGLPDQLKLYSEFLGKQPWFAGDKITFADFLVYDVLDQHRMFEPTCLDAFPN
LKDFMARFEGLRKISAYMKTSRFLPSPVYLKQATWGNE
NT seq 657 nt   +upstreamnt  +downstreamnt
atgcccgtgactctgggttattgggatatccgtggactgggtcacgccatccgcctgctc
ctggaatacacagaaacaggctatgaagagaagagatacgccatgggggacgctcctgac
tatgacagaagccagtggctgaatgacaagttcaagctggacctggactttcccaatctg
ccctacttaattgatgggtcacacaaggtcacccagagcaatgccatcctgcgctacctt
ggccggaagcacaacctgtgtggagagacagaggaggagaggatccgtgtggacattttg
gagaaacaggtcatggacactcgaattcagatgggcatgctttgctacagcgctgacttt
gagaaacggaagccagagttcttgaagggcctcccagatcagctgaaactctactcggag
ttcctggggaagcagccatggtttgcaggggacaagatcacctttgcagacttcctcgtc
tatgatgtccttgatcagcatcgaatgtttgaacccacgtgcctggacgccttcccaaac
ctgaaggacttcatggcccgctttgagggcctgaggaagatctctgcctatatgaagacc
agccgcttccttccaagtcctgtgtacttaaaacaggccacgtggggcaatgagtaa

KEGG   Mus musculus (house mouse): 14869
Entry
14869             CDS       T01002                                 
Symbol
Gstp2, GSTpiA, Gst-3, Gst3
Name
(RefSeq) glutathione S-transferase, pi 2
  KO
K23790  glutathione S-transferase P [EC:2.5.1.18]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu01524  Platinum drug resistance
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis - DNA adducts
mmu05215  Prostate cancer
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    14869 (Gstp2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    14869 (Gstp2)
   00982 Drug metabolism - cytochrome P450
    14869 (Gstp2)
   00983 Drug metabolism - other enzymes
    14869 (Gstp2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14869 (Gstp2)
   05204 Chemical carcinogenesis - DNA adducts
    14869 (Gstp2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    14869 (Gstp2)
   05215 Prostate cancer
    14869 (Gstp2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    14869 (Gstp2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    14869 (Gstp2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    14869 (Gstp2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     14869 (Gstp2)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   14869 (Gstp2)
SSDB
Motif
Pfam: GST_C_3 GST_C GST_N GST_C_2
Other DBs
NCBI-GeneID: 14869
NCBI-ProteinID: NP_861461
MGI: 95864
Ensembl: ENSMUSG00000038155
UniProt: P46425
LinkDB
Position
19:complement(4090288..4092221)
AA seq 210 aa
MPPYTIVYFPSPGRCEAMRMLLADQGQSWKEEVVTIDTWMQGLLKPTCLYGQLPKFEDGD
LTLYQSNAILRHLGRSLGLYGKNQREAAQVDMVNDGVEDLRGKYGTMIYRNYENGKNDYV
KALPGHLKPFETLLSQNQGGKAFIVGDQISFADYNLLDLLLIHQVLAPGCLDNFPLLSAY
VARLSARPKIKAFLSSPEHVNRPINGNGKQ
NT seq 633 nt   +upstreamnt  +downstreamnt
atgccgccgtacaccattgtctacttcccaagtccagggcggtgtgaggccatgcgcatg
ctgctggctgaccagggccagagctggaaggaggaggtggttaccatagatacctggatg
caaggcttgctcaagcccacttgtctgtatgggcagctccccaagtttgaggatggagac
ctcaccctttaccaatctaatgccatcttgagacaccttggccgctctttggggctttat
gggaaaaaccagagggaggccgcccaggtggatatggtgaatgatggggtggaggacctt
cgcggcaaatatggcaccatgatctacagaaactatgagaatggtaagaatgactacgtg
aaggccctgcctgggcatctgaagccttttgagaccctgctgtcccagaaccagggaggc
aaagctttcatcgtgggtgaccagatctcctttgccgattacaacttgctggacctgctg
ctgatccaccaagtcctggcccctggctgcctggacaacttccccctgctctctgcctat
gtggctcgcctcagtgcccggcccaagatcaaggcctttctgtcctccccggaacatgtg
aaccgtcccatcaatggcaatggcaaacagtag

KEGG   Mus musculus (house mouse): 14870
Entry
14870             CDS       T01002                                 
Symbol
Gstp1, GstpiB
Name
(RefSeq) glutathione S-transferase, pi 1
  KO
K23790  glutathione S-transferase P [EC:2.5.1.18]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu01524  Platinum drug resistance
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis - DNA adducts
mmu05215  Prostate cancer
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    14870 (Gstp1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    14870 (Gstp1)
   00982 Drug metabolism - cytochrome P450
    14870 (Gstp1)
   00983 Drug metabolism - other enzymes
    14870 (Gstp1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14870 (Gstp1)
   05204 Chemical carcinogenesis - DNA adducts
    14870 (Gstp1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    14870 (Gstp1)
   05215 Prostate cancer
    14870 (Gstp1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    14870 (Gstp1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    14870 (Gstp1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    14870 (Gstp1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     14870 (Gstp1)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   14870 (Gstp1)
SSDB
Motif
Pfam: GST_C_3 GST_C GST_N GST_C_2
Other DBs
NCBI-GeneID: 14870
NCBI-ProteinID: NP_038569
MGI: 95865
Ensembl: ENSMUSG00000060803
UniProt: P19157
Structure
LinkDB
Position
19:complement(4085411..4087912)
AA seq 210 aa
MPPYTIVYFPVRGRCEAMRMLLADQGQSWKEEVVTIDTWMQGLLKPTCLYGQLPKFEDGD
LTLYQSNAILRHLGRSLGLYGKNQREAAQMDMVNDGVEDLRGKYVTLIYTNYENGKNDYV
KALPGHLKPFETLLSQNQGGKAFIVGDQISFADYNLLDLLLIHQVLAPGCLDNFPLLSAY
VARLSARPKIKAFLSSPEHVNRPINGNGKQ
NT seq 633 nt   +upstreamnt  +downstreamnt
atgccaccatacaccattgtctacttcccagttcgagggcggtgtgaggccatgcgaatg
ctgctggctgaccagggccagagctggaaggaggaggtggttaccatagatacctggatg
caaggcttgctcaagcccacttgtctgtatgggcagctccccaagtttgaggatggagac
ctcaccctttaccaatctaatgccatcttgagacaccttggccgctctttggggctttat
gggaaaaaccagagggaggccgcccagatggatatggtgaatgatggggtggaggacctt
cgcggcaaatatgtcaccctcatctacaccaactatgagaatggtaagaatgactacgtg
aaggccctgcctgggcatctgaagccttttgagaccctgctgtcccagaaccagggaggc
aaagctttcatcgtgggtgaccagatctcctttgccgattacaacttgctggacctgctg
ctgatccaccaagtcctggcccctggctgcctggacaacttccccctgctctctgcctat
gtggctcgcctcagtgcccggcccaagatcaaggcctttctgtcctccccggaacatgtg
aaccgtcccatcaatggcaatggcaaacagtag

KEGG   Mus musculus (house mouse): 14871
Entry
14871             CDS       T01002                                 
Symbol
Gstt1, AI255817, Gstt1-1
Name
(RefSeq) glutathione S-transferase, theta 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu01524  Platinum drug resistance
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis - DNA adducts
mmu05207  Chemical carcinogenesis - receptor activation
mmu05208  Chemical carcinogenesis - reactive oxygen species
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    14871 (Gstt1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    14871 (Gstt1)
   00982 Drug metabolism - cytochrome P450
    14871 (Gstt1)
   00983 Drug metabolism - other enzymes
    14871 (Gstt1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14871 (Gstt1)
   05204 Chemical carcinogenesis - DNA adducts
    14871 (Gstt1)
   05207 Chemical carcinogenesis - receptor activation
    14871 (Gstt1)
   05208 Chemical carcinogenesis - reactive oxygen species
    14871 (Gstt1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    14871 (Gstt1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    14871 (Gstt1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    14871 (Gstt1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    14871 (Gstt1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     14871 (Gstt1)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   14871 (Gstt1)
SSDB
Motif
Pfam: GST_N GST_N_3 GST_C GST_N_2 GST_C_2 GST_C_3
Other DBs
NCBI-GeneID: 14871
NCBI-ProteinID: NP_032211
MGI: 107379
Ensembl: ENSMUSG00000001663
UniProt: Q64471 Q9DCY6
LinkDB
Position
10:complement(75619647..75634418)
AA seq 240 aa
MVLELYLDLLSQPCRAIYIFAKKNNIPFQMHTVELRKGEHLSDAFARVNPMKRVPAMMDG
GFTLCESVAILLYLAHKYKVPDHWYPQDLQARARVDEYLAWQHTGLRRSCLRALWHKVMF
PVFLGEQIPPETLAATLAELDVNLQVLEDKFLQDKDFLVGPHISLADLVAITELMHPVGG
GCPVFEGHPRLAAWYQRVEAAVGKDLFREAHEVILKVKDCPPADLIIKQKLMPRVLAMIQ
NT seq 723 nt   +upstreamnt  +downstreamnt
atggttctggagctgtacctggatctgctgtcgcagccctgtcgcgccatttatatcttc
gccaagaagaacaatatcccgttccagatgcacacggtggagctgcgcaagggtgagcac
ctcagcgatgcgtttgcccgggtgaaccccatgaagagggtaccagccatgatggatggt
ggcttcaccctgtgtgagagtgtggctatcttgctctacctggcacacaagtataaggtt
cctgaccactggtacccccaagacctgcaggctcgtgctcgtgtagacgagtacctggca
tggcagcatacgggccttcggagaagctgcctcagggccctgtggcataaggtgatgttc
cctgttttccttggtgagcaaatacctcctgaaacactggcagccacgttggcagaactg
gatgttaacctacaggtgcttgaagacaagttcctccaggacaaagacttccttgttggg
ccccacatctccctggccgacttggtggccatcacagagctgatgcatcctgtaggtggt
ggctgcccagtctttgaagggcatcccaggctggctgcatggtaccagcgagtggaggca
gctgtggggaaggacctcttccgggaagcccatgaagtcatcctgaaggtgaaggactgt
ccccctgctgacctcatcataaagcagaagctgatgcccagagtgctggcaatgatccag
tga

KEGG   Mus musculus (house mouse): 14872
Entry
14872             CDS       T01002                                 
Symbol
Gstt2, AI266894, Yrs, mGSTT2
Name
(RefSeq) glutathione S-transferase, theta 2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu01524  Platinum drug resistance
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis - DNA adducts
mmu05207  Chemical carcinogenesis - receptor activation
mmu05208  Chemical carcinogenesis - reactive oxygen species
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    14872 (Gstt2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    14872 (Gstt2)
   00982 Drug metabolism - cytochrome P450
    14872 (Gstt2)
   00983 Drug metabolism - other enzymes
    14872 (Gstt2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14872 (Gstt2)
   05204 Chemical carcinogenesis - DNA adducts
    14872 (Gstt2)
   05207 Chemical carcinogenesis - receptor activation
    14872 (Gstt2)
   05208 Chemical carcinogenesis - reactive oxygen species
    14872 (Gstt2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    14872 (Gstt2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    14872 (Gstt2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    14872 (Gstt2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    14872 (Gstt2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     14872 (Gstt2)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   14872 (Gstt2)
SSDB
Motif
Pfam: GST_N GST_N_3 GST_C GST_N_2 GST_C_3 GST_C_2
Other DBs
NCBI-GeneID: 14872
NCBI-ProteinID: NP_034491
MGI: 106188
Ensembl: ENSMUSG00000033318
UniProt: Q61133
LinkDB
Position
10:complement(75667676..75673253)
AA seq 244 aa
MGLELYLDLLSQPSRAVYIFAKKNGIPFQTRTVDILKGQHMSEQFSQVNCLNKVPVLKDG
SFVLTESTAILIYLSSKYQVADHWYPADLQARAQVHEYLGWHADNIRGTFGVLLWTKVLG
PLIGVQVPQEKVERNRDRMVLVLQQLEDKFLRDRAFLVGQQVTLADLMSLEELMQPVALG
YNLFEGRPQLTAWRERVEAFLGAELCQEAHSTILSILGQAAKKMLPVPPPEVHASMQLRI
ARIP
NT seq 735 nt   +upstreamnt  +downstreamnt
atgggcttggagctctacctggacctgctgtcacaacccagccgcgctgtctacatcttc
gccaagaagaatggcatccccttccagacgcgtaccgtggatatactcaaagggcagcac
atgagcgagcaattctcccaggtgaactgcttaaacaaagttcctgtactcaaagacgga
agcttcgtgttgaccgaaagcacagccatcttgatttacctgagttccaagtaccaggtg
gcagaccactggtacccggccgacctacaggcccgtgcccaagtccacgaatacctgggc
tggcatgccgacaacatccgtggtactttcggagtgctcctatggaccaaggtgttgggg
ccactcattggggtccaggttccccaggagaaggtggaacggaacagagatagaatggtc
ctggttctgcaacagctggaggacaagttcctcagggacagggccttccttgttggccag
caggtgacgctagcggatctcatgtctctggaggagttgatgcagcccgtggctcttggc
tataacctgtttgagggacggcctcagctgacagcatggcgagagagggtggaggcgttc
ttgggtgctgagctgtgtcaggaggctcatagcaccatcctgagcatcctgggacaggca
gccaagaaaatgttaccagtaccccctccggaggtccatgccagcatgcagcttcgaatt
gctaggattccttga

KEGG   Mus musculus (house mouse): 14873
Entry
14873             CDS       T01002                                 
Symbol
Gsto1, AA407097, AI194287, AU018802, Gsto-1, Gstx, Spg-r, p28
Name
(RefSeq) glutathione S-transferase omega 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu01524  Platinum drug resistance
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis - DNA adducts
mmu05207  Chemical carcinogenesis - receptor activation
mmu05208  Chemical carcinogenesis - reactive oxygen species
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    14873 (Gsto1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    14873 (Gsto1)
   00982 Drug metabolism - cytochrome P450
    14873 (Gsto1)
   00983 Drug metabolism - other enzymes
    14873 (Gsto1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14873 (Gsto1)
   05204 Chemical carcinogenesis - DNA adducts
    14873 (Gsto1)
   05207 Chemical carcinogenesis - receptor activation
    14873 (Gsto1)
   05208 Chemical carcinogenesis - reactive oxygen species
    14873 (Gsto1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    14873 (Gsto1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    14873 (Gsto1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    14873 (Gsto1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    14873 (Gsto1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     14873 (Gsto1)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   14873 (Gsto1)
SSDB
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C GST_C_2 GST_C_3 Glutaredoxin
Other DBs
NCBI-GeneID: 14873
NCBI-ProteinID: NP_034492
MGI: 1342273
Ensembl: ENSMUSG00000025068
UniProt: O09131
LinkDB
Position
19:47843412..47853229
AA seq 240 aa
MSGESSRSLGKGSAPPGPVPEGQIRVYSMRFCPFAQRTLMVLKAKGIRHEVININLKNKP
EWFFEKNPLGLVPVLENSQGHLVTESVITCEYLDEAYPEKKLFPDDPYKKARQKMTLESF
SKVPPLIASFVRSKRKEDSPNLREALENEFKKLEEGMDNYKSFLGGDSPSMVDYLTWPWF
QRLEALELKECLAHTPKLKLWMAAMQQDPVASSHKIDAKTYREYLNLYLQDSPEACDYGL
NT seq 723 nt   +upstreamnt  +downstreamnt
atgtcgggagaatcctccaggagcctggggaagggaagcgcgccccccggcccggtcccg
gagggccagatccgcgtctacagcatgaggttctgccccttcgctcagaggacgctgatg
gtcctgaaggccaagggaatccggcacgaagtcatcaatatcaacctgaagaataagccc
gagtggttctttgagaagaatccccttgggctggtgccggttctggagaacagccagggt
cacttggtcaccgaatctgtcatcacttgtgagtacctggatgaggcctacccagagaag
aagttatttccagatgacccgtacaagaaggcacgtcagaagatgacccttgagtcattc
tctaaggtgccgcctttgattgcaagctttgttaggtcgaagagaaaggaagactctccg
aacctaagggaagcgttggagaacgaattcaaaaagctagaggagggcatggataattac
aagagcttccttggtggggattctccttctatggttgattatcttacttggccttggttt
cagcgactggaagcattggagctcaaggagtgtctagcccacacccccaagctcaagctc
tggatggcggccatgcagcaagaccctgtggcatcctctcacaaaattgatgccaagacc
taccgcgagtacttaaatctctacctacaggacagccccgaggcctgtgattatgggctc
tga

KEGG   Mus musculus (house mouse): 211666
Entry
211666            CDS       T01002                                 
Symbol
Mgst2, GST2, MGST-II
Name
(RefSeq) microsomal glutathione S-transferase 2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu01524  Platinum drug resistance
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis - DNA adducts
mmu05207  Chemical carcinogenesis - receptor activation
mmu05208  Chemical carcinogenesis - reactive oxygen species
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    211666 (Mgst2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    211666 (Mgst2)
   00982 Drug metabolism - cytochrome P450
    211666 (Mgst2)
   00983 Drug metabolism - other enzymes
    211666 (Mgst2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    211666 (Mgst2)
   05204 Chemical carcinogenesis - DNA adducts
    211666 (Mgst2)
   05207 Chemical carcinogenesis - receptor activation
    211666 (Mgst2)
   05208 Chemical carcinogenesis - reactive oxygen species
    211666 (Mgst2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    211666 (Mgst2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    211666 (Mgst2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    211666 (Mgst2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    211666 (Mgst2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     211666 (Mgst2)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   211666 (Mgst2)
SSDB
Motif
Pfam: MAPEG
Other DBs
NCBI-GeneID: 211666
NCBI-ProteinID: NP_778160
MGI: 2448481
Ensembl: ENSMUSG00000074604
UniProt: A2RST1
LinkDB
Position
3:51544179..51590096
AA seq 147 aa
MAGDSSLLAAVSLLSACQQSYFAWRVGRARLKHKIAPPAVTGPLEFERIFRAQQNSLEFY
PVFIVMLWMAGWYFNQVFAACLGLLYIYARHKYFWGYAEAAEKRITGFRLSLGILTLLPV
LAVLGVASRFLNEYLDFHVAKKLRKPF
NT seq 444 nt   +upstreamnt  +downstreamnt
atggccggggattcaagcctgctggctgcagtctctcttctctctgcctgtcagcaaagt
tatttcgcttggcgggtcggacgagcaagactaaaacacaagattgcacccccagcagtc
acgggccctctggaattcgagagaatatttcgtgcacagcaaaactctttggagttttat
cctgtattcatcgtaatgctgtggatggctgggtggtacttcaatcaagtttttgcagcc
tgtctgggtctcctgtacatatacgcccgtcacaagtatttctggggctatgccgaagcc
gctgagaaaaggatcaccggtttccgactgagcctggggattttgaccttgctgcctgtc
ctcgctgtcctgggggtagcaagcagattcctgaacgaatacctggactttcatgttgcc
aagaaactgaggaagcccttctaa

KEGG   Mus musculus (house mouse): 225884
Entry
225884            CDS       T01002                                 
Symbol
Gstp3
Name
(RefSeq) glutathione S-transferase pi 3
  KO
K23790  glutathione S-transferase P [EC:2.5.1.18]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu01524  Platinum drug resistance
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis - DNA adducts
mmu05215  Prostate cancer
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    225884 (Gstp3)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    225884 (Gstp3)
   00982 Drug metabolism - cytochrome P450
    225884 (Gstp3)
   00983 Drug metabolism - other enzymes
    225884 (Gstp3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    225884 (Gstp3)
   05204 Chemical carcinogenesis - DNA adducts
    225884 (Gstp3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    225884 (Gstp3)
   05215 Prostate cancer
    225884 (Gstp3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    225884 (Gstp3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    225884 (Gstp3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    225884 (Gstp3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     225884 (Gstp3)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   225884 (Gstp3)
SSDB
Motif
Pfam: GST_C_3 GST_C GST_N GST_C_2
Other DBs
NCBI-GeneID: 225884
NCBI-ProteinID: NP_001348972
MGI: 2385078
Ensembl: ENSMUSG00000058216
LinkDB
Position
19:complement(4107470..4109587)
AA seq 193 aa
MRMLLADQGQSWKEEVVTLDVWEQGTFKASCLFGQIPKFQDGELTLYQSNTILRHLGRSF
GLYGKDQQEAALVDMVNDGLEDLFRRIARQYRHILKEGKDQYQKELPGHLKPFETLLAQN
RGGQSFIVGDQISFADYRLLDVLLNLELLFPGYLNDFPLFSAYVARLKSRPKLKAFLESP
EHVNRPLAACIKM
NT seq 582 nt   +upstreamnt  +downstreamnt
atgcgcatgcttctagctgaccagggccagagctggaaggaggaggtggtgaccttggat
gtttgggagcaaggcacattcaaggcttcctgtttgtttggacagatccccaagttccag
gatggagagctcaccctgtaccaatccaatactatcctacggcacctgggccgctccttc
gggctctatggcaaagaccaacaagaggcagcactggtggacatggtgaacgatggactg
gaagacctattcagacgcattgcccggcagtatcgccatatcctgaaggagggcaaggac
cagtatcagaaggagcttccgggacacctgaagccatttgaaactctcctggcccagaac
aggggtggccagtccttcattgttggtgaccagatctctttcgcggactaccgcctgctg
gacgtgcttctgaatctcgagctcctgtttcctggttacttgaatgactttcccctgttc
tccgcctatgtggcgcgcctcaaatcccgacccaagctcaaggccttcctggagtctcct
gagcatgtgaaccggcccctggctgcttgcataaagatgtga

KEGG   Mus musculus (house mouse): 56615
Entry
56615             CDS       T01002                                 
Symbol
Mgst1, 1500002K10Rik, Gst
Name
(RefSeq) microsomal glutathione S-transferase 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu01524  Platinum drug resistance
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis - DNA adducts
mmu05207  Chemical carcinogenesis - receptor activation
mmu05208  Chemical carcinogenesis - reactive oxygen species
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    56615 (Mgst1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    56615 (Mgst1)
   00982 Drug metabolism - cytochrome P450
    56615 (Mgst1)
   00983 Drug metabolism - other enzymes
    56615 (Mgst1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    56615 (Mgst1)
   05204 Chemical carcinogenesis - DNA adducts
    56615 (Mgst1)
   05207 Chemical carcinogenesis - receptor activation
    56615 (Mgst1)
   05208 Chemical carcinogenesis - reactive oxygen species
    56615 (Mgst1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    56615 (Mgst1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    56615 (Mgst1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    56615 (Mgst1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    56615 (Mgst1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     56615 (Mgst1)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   56615 (Mgst1)
SSDB
Motif
Pfam: MAPEG
Other DBs
NCBI-GeneID: 56615
NCBI-ProteinID: NP_064330
MGI: 1913850
Ensembl: ENSMUSG00000008540
UniProt: Q91VS7 Q53ZD4
LinkDB
Position
6:138117525..138133753
AA seq 155 aa
MADLRQLMDNEVLMAFTSYATIILTKMMFMSSATAFQRITNKVFANPEDCAGFGKGENAK
KFVRTDEKVERVRRAHLNDLENIVPFLGIGLLYSLSGPDLSTALMHFRIFVGARIYHTIA
YLTPLPQPNRGLAFFVGYGVTLSMAYRLLRSRLYL
NT seq 468 nt   +upstreamnt  +downstreamnt
atggccgacctcaggcagctcatggacaatgaggtgttgatggcctttacctcctatgca
acgatcattcttaccaagatgatgttcatgagctctgcgaccgcattccagaggataacc
aacaaggtttttgccaacccagaagactgcgctggctttggcaagggagagaatgccaag
aagtttgttcgcactgacgagaaggtggaacgcgtgcgcagagcccacctgaatgatctt
gaaaacatcgttccctttctcggcatcggcctcctgtactccctgagtggaccagatctc
tctacagccctcatgcacttcagaatctttgtaggtgctcggatctaccacaccattgct
tacttgactccccttcctcagccaaacaggggcttggcattttttgttggctatggagtt
actttgtcaatggcttacaggctgctaaggagcagactgtacttgtaa

KEGG   Mus musculus (house mouse): 66447
Entry
66447             CDS       T01002                                 
Symbol
Mgst3, 2010012L10Rik, 2010306B17Rik, 2700004G04Rik, AA516734, GST-III
Name
(RefSeq) microsomal glutathione S-transferase 3
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu01524  Platinum drug resistance
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis - DNA adducts
mmu05207  Chemical carcinogenesis - receptor activation
mmu05208  Chemical carcinogenesis - reactive oxygen species
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    66447 (Mgst3)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    66447 (Mgst3)
   00982 Drug metabolism - cytochrome P450
    66447 (Mgst3)
   00983 Drug metabolism - other enzymes
    66447 (Mgst3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    66447 (Mgst3)
   05204 Chemical carcinogenesis - DNA adducts
    66447 (Mgst3)
   05207 Chemical carcinogenesis - receptor activation
    66447 (Mgst3)
   05208 Chemical carcinogenesis - reactive oxygen species
    66447 (Mgst3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    66447 (Mgst3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    66447 (Mgst3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    66447 (Mgst3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    66447 (Mgst3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     66447 (Mgst3)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   66447 (Mgst3)
SSDB
Motif
Pfam: MAPEG
Other DBs
NCBI-GeneID: 66447
NCBI-ProteinID: NP_079845
MGI: 1913697
Ensembl: ENSMUSG00000026688
UniProt: Q9CPU4
LinkDB
Position
1:complement(167199535..167221410)
AA seq 153 aa
MAVLSKEYGFVLLTGAASFVMVLHLAINVGKARKKYKVEYPVMYSTDPENGHMFNCIQRA
HQNTLEVYPPFLFFLTVGGVYHPRIASGLGLAWIIGRVLYAYGYYTGDPSKRYRGAVGSL
ALFALMGTTVCSAFQHLGWIRPGLGYGSRSCHH
NT seq 462 nt   +upstreamnt  +downstreamnt
atggctgtcctctctaaggagtatggatttgtgcttctcactggtgctgccagctttgtg
atggtgctccacctagccatcaacgtgggcaaagcccgcaagaagtacaaggtagagtac
cctgtcatgtacagcacagatcctgagaacgggcatatgttcaactgcattcagcgcgcc
caccagaacacgttggaggtgtaccctcccttcctgtttttcctaacggtgggaggtgtt
taccacccgcgcatagcttctggcctgggcctggcctggattattgggcgagtcctttac
gcatatggctactacacaggagaccctagcaagcggtatcgaggagccgtgggctctctt
gccctctttgccctgatgggcaccaccgtgtgctctgctttccagcatctcggctggatc
agaccaggcttaggctacgggtccagatcctgccaccactga

KEGG   Mus musculus (house mouse): 68214
Entry
68214             CDS       T01002                                 
Symbol
Gsto2, 1700020F09Rik, 4930425C18Rik, GSTO_2-2
Name
(RefSeq) glutathione S-transferase omega 2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu01524  Platinum drug resistance
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis - DNA adducts
mmu05207  Chemical carcinogenesis - receptor activation
mmu05208  Chemical carcinogenesis - reactive oxygen species
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    68214 (Gsto2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    68214 (Gsto2)
   00982 Drug metabolism - cytochrome P450
    68214 (Gsto2)
   00983 Drug metabolism - other enzymes
    68214 (Gsto2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    68214 (Gsto2)
   05204 Chemical carcinogenesis - DNA adducts
    68214 (Gsto2)
   05207 Chemical carcinogenesis - receptor activation
    68214 (Gsto2)
   05208 Chemical carcinogenesis - reactive oxygen species
    68214 (Gsto2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    68214 (Gsto2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    68214 (Gsto2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    68214 (Gsto2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    68214 (Gsto2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     68214 (Gsto2)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   68214 (Gsto2)
SSDB
Motif
Pfam: GST_N_3 GST_N_2 GST_N Glutaredoxin GST_C_2 GST_C_3 GST_C
Other DBs
NCBI-GeneID: 68214
NCBI-ProteinID: NP_080895
MGI: 1915464
Ensembl: ENSMUSG00000025069
UniProt: Q8K2Q2 Q8BW12 Q9D2S1
LinkDB
Position
19:47853879..47874747
AA seq 248 aa
MSGDLSRCLGKGSCPPGPVPEGVIRIYSMRFCPYSHRARLVLKAKGIRHEVININLKSKP
DWYYTKHPFGQIPVLENSQCQLVYESVIACEYLDDVYPGRKLFPYDPYERARQKMLLELF
CKVPPLSKECLIALRCGRDCTDLKVALRQELCNMEEILEYQNTTFFGGDCISMIDYLVWP
WFERLDVYGLADCVNHTPMLRLWIASMKQDPAVCALHTDKSVFLGFLNLYFQNNPCAFDF
GLCNPIIR
NT seq 747 nt   +upstreamnt  +downstreamnt
atgtccggggatttgtcaagatgcttgggaaaaggaagctgtcccccagggccggtccct
gagggtgtgatccgaatctacagcatgaggttctgcccctactcgcacagggcacgcctg
gttctcaaggccaaaggcatcaggcatgaagtgatcaatattaacctgaaaagcaagcct
gactggtactatacaaagcatccttttggccaaattcctgtcttggagaacagccagtgt
cagctggtctatgaatctgtcattgcttgtgagtacctggatgacgtctacccgggaaga
aagctgtttccgtatgacccgtatgaacgagctcgccagaagatgttattggagctattc
tgtaaggtcccgcctttaagcaaggaatgtctgatagcgctgagatgcggaagagactgt
acggatctgaaggtcgccctgcgtcaggagttgtgcaacatggaagagattcttgaatat
cagaacactaccttcttcggcggagactgtatatccatgattgattacctcgtctggccc
tggtttgagcgcctggacgtatatggactggctgactgcgtgaatcacaccccgatgctg
cggctctggatagcctccatgaagcaggaccctgcagtgtgtgctctgcacactgataag
agcgtcttcctgggcttcttgaatctctatttccaaaacaacccttgtgcctttgatttt
gggctgtgtaacccaatcatacgataa

KEGG   Mus musculus (house mouse): 68312
Entry
68312             CDS       T01002                                 
Symbol
Gstm7, 0610005A07Rik, AI894236, Cd203c
Name
(RefSeq) glutathione S-transferase, mu 7
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu01524  Platinum drug resistance
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis - DNA adducts
mmu05207  Chemical carcinogenesis - receptor activation
mmu05208  Chemical carcinogenesis - reactive oxygen species
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    68312 (Gstm7)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    68312 (Gstm7)
   00982 Drug metabolism - cytochrome P450
    68312 (Gstm7)
   00983 Drug metabolism - other enzymes
    68312 (Gstm7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    68312 (Gstm7)
   05204 Chemical carcinogenesis - DNA adducts
    68312 (Gstm7)
   05207 Chemical carcinogenesis - receptor activation
    68312 (Gstm7)
   05208 Chemical carcinogenesis - reactive oxygen species
    68312 (Gstm7)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    68312 (Gstm7)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    68312 (Gstm7)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    68312 (Gstm7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    68312 (Gstm7)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     68312 (Gstm7)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   68312 (Gstm7)
SSDB
Motif
Pfam: GST_N GST_C_3 GST_C GST_C_6 GST_C_2 GST_N_3 Bromo_TP
Other DBs
NCBI-GeneID: 68312
NCBI-ProteinID: NP_080948
MGI: 1915562
Ensembl: ENSMUSG00000004035
UniProt: Q80W21
Structure
LinkDB
Position
3:complement(107833650..107839193)
AA seq 218 aa
MPMTLGYWDIRGLAHAIRLFLEYTDSSYEEKRYTMGDAPDYDQSQWLNEKFKLGLDFPNL
PYLIDGSHKITQSNAILRYLGRKHNLCGETEEERIRVDILENQLMDNRMVLARLCYNADF
EKLKPGYLEQLPGMMRLYSEFLGKRPWFAGDKITFVDFIAYDVLERNQVFEAKCLDAFPN
LKDFIARFEGLKKISDYMKTSRFLPRPMFTKMATWGSN
NT seq 657 nt   +upstreamnt  +downstreamnt
atgcccatgacactgggttactgggacatccgtgggctagcccatgccattcgcctgttc
ctggaatacacagactcaagctatgaggagaagagatacaccatgggtgatgctcctgac
tatgaccaaagccagtggctgaatgagaaattcaagctgggcctggactttcctaacctg
ccctacttgatcgatgggtcacacaagatcacgcagagcaatgccatcctgcgctacctt
ggccgcaagcacaacctgtgtggggagacagaggaggaaaggatccgtgtggatattctg
gagaatcagcttatggacaaccgcatggtgctggcgaggctttgctacaacgctgacttt
gagaagctgaagccagggtacctggagcaactccctggaatgatgaggctttactctgag
ttcctgggcaagcggccatggttcgcaggggacaagatcacctttgtggatttcattgct
tacgatgtgcttgagaggaaccaagtgtttgaggccaagtgcctggatgcgttcccaaac
ctgaaggacttcatagcgcgctttgagggcctgaagaagatctccgactacatgaagacc
agtcgcttcctcccaagacccatgttcacaaagatggcaacttggggcagcaattag

KEGG   Mus musculus (house mouse): 75886
Entry
75886             CDS       T01002                                 
Symbol
Gstt4, 4930583C14Rik, AI507011
Name
(RefSeq) glutathione S-transferase, theta 4
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu01524  Platinum drug resistance
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis - DNA adducts
mmu05207  Chemical carcinogenesis - receptor activation
mmu05208  Chemical carcinogenesis - reactive oxygen species
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    75886 (Gstt4)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    75886 (Gstt4)
   00982 Drug metabolism - cytochrome P450
    75886 (Gstt4)
   00983 Drug metabolism - other enzymes
    75886 (Gstt4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    75886 (Gstt4)
   05204 Chemical carcinogenesis - DNA adducts
    75886 (Gstt4)
   05207 Chemical carcinogenesis - receptor activation
    75886 (Gstt4)
   05208 Chemical carcinogenesis - reactive oxygen species
    75886 (Gstt4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    75886 (Gstt4)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    75886 (Gstt4)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    75886 (Gstt4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    75886 (Gstt4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     75886 (Gstt4)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   75886 (Gstt4)
SSDB
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_3 GST_C_2 Glutaredoxin
Other DBs
NCBI-GeneID: 75886
NCBI-ProteinID: NP_083748
MGI: 1923136
Ensembl: ENSMUSG00000009093
UniProt: Q9D4P7
LinkDB
Position
10:complement(75650777..75658405)
AA seq 240 aa
MGLELYMDLLSAPCRAVYIFARKNGIPFDFQFVDLLKGHHHSKEYIEINPLRKLPSLKDG
KFILSESVAILFYLCRKYSAPSHWYPPDLHMRARVDEFMAWQHTAIQVPMSKILWIKLII
PMITGEEVPTERLEKTLDEVKRNLQQFEEKFLQDKMFITGDHISLADLVALVEMMQPMGS
NHNVFVSSKLAEWRMRVELAIGSGLFWEAHERLVKLPNWDCSTLDPTIKMRICDFLQKFK
NT seq 723 nt   +upstreamnt  +downstreamnt
atgggcctggagctgtacatggatctgctgtcggcgccttgccgcgctgtctacattttt
gccaggaagaatggcatccccttcgacttccaatttgtggatctattaaaaggtcaccac
catagcaaggaatacatcgaaatcaaccccctgaggaagcttcccagcctcaaggacggc
aagttcatcttatctgaaagtgtggctatcctcttctacctatgtcgcaagtacagtgcg
ccttcccattggtacccaccggatctgcacatgcgtgcccgcgtggacgagtttatggcc
tggcagcatacagctattcaggtgcccatgagcaagatcctgtggattaagttgataatc
ccaatgatcacgggtgaggaggttcccactgagagattagagaagacactggatgaggtg
aagagaaacctacagcaatttgaggagaagtttctgcaggacaagatgttcatcactggg
gaccatatctcactggctgacttggtggcgctggtagaaatgatgcagccaatggggagt
aatcacaatgtctttgtcagctctaagcttgcagaatggcgaatgcgggtggagttagcc
atcggctctggcctcttctgggaggctcatgaaagactggtgaagttaccaaactgggac
tgttcgacactagaccctacgatcaagatgaggatttgtgactttctgcagaagtttaag
tga

DBGET integrated database retrieval system