KEGG   Mus musculus (house mouse): 100043861
Entry
100043861         CDS       T01002                                 
Symbol
Klrb1, 4930431A04Rik, Gm4696, Klrb1g, Klrb6, Ly-55, Ly55, NKR-P1G, Nkrp-1e, Nkrp1g
Name
(RefSeq) killer cell lectin-like receptor subfamily B member 1
  KO
K06543  killer cell lectin-like receptor subfamily B
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05144  Malaria
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    100043861 (Klrb1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    100043861 (Klrb1)
   04091 Lectins [BR:mmu04091]
    100043861 (Klrb1)
CD molecules [BR:mmu04090]
 Proteins
  100043861 (Klrb1)
Lectins [BR:mmu04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   100043861 (Klrb1)
SSDB
Motif
Pfam: Lectin_C
Other DBs
NCBI-GeneID: 100043861
NCBI-ProteinID: NP_001093388
MGI: 96877
Ensembl: ENSMUSG00000079299
UniProt: Q0ZUP1 A0A1U9W1A8
LinkDB
Position
6:complement(128683056..128701293)
AA seq 214 aa
MDAPVLYAELNLAETRGLRCTSAPSLPQDACQGPGWHRVALKLGCAGLIFLLMVLSVLVG
FLVQKPLIEKCSVAVQENRTEPTGRSATLECPRDWHPHCDKCLFTSQTSRPWADGLVDCN
LKGATLLLIQDEEELRLLQNFSKGKGQQFYIGLKYEEVDKVWKWMNGSILNTNLLQITGK
DEENSCALISQTEVFSDSCSSDNHWICQKTLKHV
NT seq 645 nt   +upstreamnt  +downstreamnt
atggatgcaccagtgctctatgctgaattaaatttagccgagaccagagggctcaggtgt
acatcagctccatctctcccccaagatgcctgtcagggaccaggctggcatcgggtggct
ctgaaactcggctgtgctgggctgatctttcttctgatggtactcagtgtcttagtggga
ttcttggtgcaaaaacctctaatagaaaaatgcagtgtggctgttcaagaaaacaggact
gaaccaacagggagatcagccacactagagtgcccgagagactggcatccacactgtgat
aaatgcttatttacttctcaaacttccagaccttgggctgacggtctggttgactgtaat
ttgaaaggagccactttgctgctcattcaagatgaagaagaattgagattattgcagaac
ttctcaaagggaaaaggacaacaattttatattggactaaaatatgaagaagtggacaag
gtttggaagtggatgaatggttctattttaaatactaatctattacaaatcactggcaag
gatgaagaaaacagctgtgccctcatctcacaaacagaagtgttttctgattcctgttct
tcagacaaccattggatctgccaaaagacactgaaacacgtctga

KEGG   Mus musculus (house mouse): 16635
Entry
16635             CDS       T01002                                 
Symbol
Klra4, Chok, Klra32, Klra33, Ly-49d, Ly49d, ly49r<129>
Name
(RefSeq) killer cell lectin-like receptor, subfamily A, member 4
  KO
K23459  killer cell lectin-like receptor subfamily A member 4
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu05144  Malaria
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    16635 (Klra4)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    16635 (Klra4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:mmu04091]
    16635 (Klra4)
Lectins [BR:mmu04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   16635 (Klra4)
SSDB
Motif
Pfam: Ly49 Lectin_C
Other DBs
NCBI-GeneID: 16635
NCBI-ProteinID: NP_001239506
MGI: 101904
Ensembl: ENSMUSG00000079852
UniProt: Q60651 Q542S4
LinkDB
Position
6:complement(130020693..130044234)
AA seq 263 aa
MTEQEDTFSAVRFHKSSGLQNEMRLKETRKPEKARLRVCSVPWQLIVIALGILISLRLVT
VAVLMTNIFQYGQQKHELKEFLKHHNNCSIMQSDINLKDELLKNKSIECNLLESLNRDQN
ILCDKTRTVLDYLQHTGRGVKVYWFCYGMKCYYFVMDRKPWSRCKQSCQNSSLTLLKIDD
EDELKFLQLVVPSDSCWIGLSYDNKKKDWAWIDNRPSKLALNTTKYNIRDGGCMFLSKTR
LDNNYCDQSFICICGKRLDKFPH
NT seq 792 nt   +upstreamnt  +downstreamnt
atgactgaacaggaagacactttctcagctgtgagattccataagtcttcagggttgcag
aacgagatgaggctcaaggagacacggaagcctgaaaaagctcgcctcagagtgtgttca
gttccctggcagctcattgtgatagctctcgggatcctcatttcccttcgactggtaact
gttgcagtgcttatgacaaacatttttcagtatggtcaacaaaaacatgaactgaaggaa
tttctaaaacaccacaataactgcagcatcatgcaaagtgacatcaacttgaaggatgaa
ctgctgaaaaataagtctatagagtgtaatcttctggaatccctcaacagggatcaaaac
atactgtgtgataaaaccaggactgttttagattacttacagcacacaggcagaggtgtt
aaagtatactggttctgttatggtatgaaatgttattatttcgtcatggacagaaaacca
tggagtagatgtaaacagagctgccagaattccagcttaacccttctgaagatagatgat
gaggatgaactgaagttccttcagctcgtggttccttcagacagttgctggattggattg
tcatatgataataagaaaaaagattgggcatggattgacaatcgcccatctaaacttgcc
ttgaacacaacgaaatacaatataagagatggaggatgtatgttcttatctaaaactaga
ctagacaataattactgtgatcaatcattcatctgtatttgtgggaagagattggacaaa
ttccctcattga

KEGG   Mus musculus (house mouse): 17057
Entry
17057             CDS       T01002                                 
Symbol
Klrb1a, Ly55a, NKR-P1.7, NKR-P1A, NKRP12, Nkrp1-a, Nkrp1a, ly-55A
Name
(RefSeq) killer cell lectin-like receptor subfamily B member 1A
  KO
K06543  killer cell lectin-like receptor subfamily B
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05144  Malaria
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    17057 (Klrb1a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    17057 (Klrb1a)
   04091 Lectins [BR:mmu04091]
    17057 (Klrb1a)
CD molecules [BR:mmu04090]
 Proteins
  17057 (Klrb1a)
Lectins [BR:mmu04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   17057 (Klrb1a)
SSDB
Motif
Pfam: Lectin_C UL45
Other DBs
NCBI-GeneID: 17057
NCBI-ProteinID: NP_034867
MGI: 107540
Ensembl: ENSMUSG00000030361
UniProt: P27811 G5E882
Structure
LinkDB
Position
6:complement(128586190..128599897)
AA seq 233 aa
MHLLCTMDTARVYFGLKPPRTPGAWHESPPSLPPDACRCPRSHRLALKLSCAGLILLVVT
LIGMSVLVRVLIQKPSIEKCYVLIQENLNKTTDCSAKLECPQDWLSHRDKCFHVSQVSNT
WEEGLVDCDGKGATLMLIQDQEELRFLLDSIKEKYNSFWIGLRYTLPDMNWKWINGSTLN
SDVLKITGDTENDSCAAISGDKVTFESCNSDNRWICQKELYHETLSNYVGYGH
NT seq 702 nt   +upstreamnt  +downstreamnt
atgcatctcctatgcacaatggacacagcaagggtctactttggtttaaagccacccagg
actccaggggcttggcatgagtcacccccatctcttcccccagatgcctgtcggtgccca
cgttcacacaggttggctctgaagctcagctgtgctgggctcatcctccttgtcgtgacc
ctgattgggatgagtgttttagtgcgagtcctaatacaaaaaccatcaatagaaaaatgc
tatgtgcttattcaagagaacctgaataaaacaacagattgttcagctaagctagagtgc
ccacaagactggctttcacaccgagataagtgctttcacgtttctcaagtttccaacact
tgggaggaaggtctagttgattgtgatggaaaaggagccactttgatgctcattcaagac
caagaagaactgagattcctactggactcaataaaggaaaaatacaattcattttggatt
ggactaaggtacacattgccagacatgaactggaagtggataaatggatcgactttaaat
tctgatgtattaaaaatcactggtgacactgaaaatgacagctgtgctgctatctcagga
gacaaagtgacttttgagagctgtaattcagacaaccgttggatctgccaaaaggaacta
taccatgaaaccctgagcaactatgtgggttatggacactga

KEGG   Mus musculus (house mouse): 17059
Entry
17059             CDS       T01002                                 
Symbol
Klrb1c, AI462337, CD161, Klrb1b, Ly-59, Ly55c, Ly59, NK-RP1, NK1.1, NKR-P1.9, NKRP1, NKRP140, Nk-1, Nk-1.2, Nk1, Nk1.2, Nkrp1b, Nkrp1c, ly-55c
Name
(RefSeq) killer cell lectin-like receptor subfamily B member 1C
  KO
K06543  killer cell lectin-like receptor subfamily B
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu05144  Malaria
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    17059 (Klrb1c)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    17059 (Klrb1c)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    17059 (Klrb1c)
   04091 Lectins [BR:mmu04091]
    17059 (Klrb1c)
CD molecules [BR:mmu04090]
 Proteins
  17059 (Klrb1c)
Lectins [BR:mmu04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   17059 (Klrb1c)
SSDB
Motif
Pfam: Lectin_C UL45
Other DBs
NCBI-GeneID: 17059
NCBI-ProteinID: NP_001153376
MGI: 107538
Ensembl: ENSMUSG00000030325
UniProt: P27814 E9Q3U6
LinkDB
Position
6:complement(128755448..128765604)
AA seq 223 aa
MDTASIYLGLKPPRTLGAWHESPPSLPPDACRCPRSHRLALKLSCAGLILLVLTLIGMSV
LVRVLVQKPSREKCCVFIQENLNKTTDCSVNLECPQDWLLHRDKCFHVSQVSNTWEEGQA
DCGRKGATLLLIQDQEELRFLLDSIKEKYNSFWIGLRFTLPDMNWKWINGTTFNSDVLKI
TGVTENGSCASILGDKVTPESCASDNRWICQKELNHETPSNDS
NT seq 672 nt   +upstreamnt  +downstreamnt
atggacacagcaagtatctacctcggtttaaagccacccaggacactgggggcttggcat
gagtcacccccatctcttcccccagatgcctgtcggtgcccacgttcacacaggttggct
ctgaagctcagctgtgctgggctcatcctccttgtcctgaccctgattgggatgagtgtc
ttagtgcgagtcttagtacaaaaaccatcaagagaaaaatgctgtgtgtttattcaagag
aacctgaataaaacaacagattgttcagttaatttagagtgcccacaagactggctttta
caccgagataagtgctttcacgtttctcaagtttccaacacttgggaggaaggtcaagct
gactgtggtagaaaaggagccactttgctgctcattcaagaccaagaagaactgagattc
ctactggactcaataaaggaaaaatataattcattttggattggactaaggttcacattg
ccagacatgaactggaagtggataaatggcacaactttcaattctgatgtactaaaaatc
actggtgtcactgaaaatggcagctgtgcctccatcttaggagataaagtgactcctgag
agctgtgcttcagacaaccgttggatctgccaaaaggaactaaaccatgaaaccccgagt
aatgactcctga

KEGG   Mus musculus (house mouse): 232408
Entry
232408            CDS       T01002                                 
Symbol
Klrb1f, A630024B12Rik, Nkr-p1f, Nkrp1-f, Nkrp1f
Name
(RefSeq) killer cell lectin-like receptor subfamily B member 1F
  KO
K06543  killer cell lectin-like receptor subfamily B
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05144  Malaria
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    232408 (Klrb1f)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    232408 (Klrb1f)
   04091 Lectins [BR:mmu04091]
    232408 (Klrb1f)
CD molecules [BR:mmu04090]
 Proteins
  232408 (Klrb1f)
Lectins [BR:mmu04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   232408 (Klrb1f)
SSDB
Motif
Pfam: Lectin_C
Other DBs
NCBI-GeneID: 232408
NCBI-ProteinID: NP_694734
MGI: 2442965
Ensembl: ENSMUSG00000030154
UniProt: Q8VD98 I3QI43
LinkDB
Position
6:129022800..129036687
AA seq 217 aa
MDTSKVHGNVKPFRCPGYKQASSPSFSPDACRCPHWHHLALKSGCAGLILLLLSLIGLSV
LVRFLVQKPPIEKCSVAAQENRTELTGRSAILECPRYWHPHWNKCLFVSQISRPWAEGRD
ACSMEDAILLLIENKEELRFVQNLIKGKEQLFFIGLKYVQKEKIWKWIDGSILNPNLLRI
TGKDKENSCAIISHTEVFSDSCSSDNHWICQKTLIHV
NT seq 654 nt   +upstreamnt  +downstreamnt
atggacacatcaaaggtccatggcaatgtaaagccatttaggtgtccagggtataagcaa
gcatcttctccatctttctccccagatgcttgtcggtgcccacactggcatcatttggct
ctgaaatctggctgtgctgggctgatccttcttctcttgagcctgattggactcagtgtc
ttagtgagattcctagtgcaaaaaccaccaatagaaaaatgcagtgtggctgctcaagag
aacaggactgaactaacaggaagatcagccatactagagtgcccgagatattggcatcca
cactggaacaaatgtttatttgtttctcaaatttccagaccttgggcagaaggtcgagat
gcctgctctatggaagacgccattttgttgctcattgaaaataaagaagaactgagattt
gtgcagaacttgataaagggaaaagaacagttattttttattggactaaaatatgtacag
aaggagaagatctggaagtggatagatggctctattttaaatcctaacctattacgaatc
actggcaaggacaaagaaaacagctgtgccatcatctcacacacggaagtgttttcagat
tcttgttcttcagacaaccactggatctgccaaaagaccctgatacatgtctga

KEGG   Mus musculus (house mouse): 27007
Entry
27007             CDS       T01002                                 
Symbol
Klrk1, D6H12S2489E, NKG2-D, Nkg2d
Name
(RefSeq) killer cell lectin-like receptor subfamily K, member 1
  KO
K06728  killer cell lectin-like receptor subfamily K member 1
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu05144  Malaria
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    27007 (Klrk1)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    27007 (Klrk1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    27007 (Klrk1)
   04091 Lectins [BR:mmu04091]
    27007 (Klrk1)
CD molecules [BR:mmu04090]
 Proteins
  27007 (Klrk1)
Lectins [BR:mmu04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   27007 (Klrk1)
SSDB
Motif
Pfam: Lectin_C Chordopox_A33R UL45
Other DBs
NCBI-GeneID: 27007
NCBI-ProteinID: NP_149069
MGI: 1196250
Ensembl: ENSMUSG00000030149
UniProt: O54709 Q4FJM0
Structure
LinkDB
Position
6:complement(129587286..129600863)
AA seq 232 aa
MALIRDRKSHHSEMSKCHNYDLKPAKWDTSQEQQKQRLALTTSQPGENGIIRGRYPIEKL
KISPMFVVRVLAIALAIRFTLNTLMWLAIFKETFQPVLCNKEVPVSSREGYCGPCPNNWI
CHRNNCYQFFNEEKTWNQSQASCLSQNSSLLKIYSKEEQDFLKLVKSYHWMGLVQIPANG
SWQWEDGSSLSYNQLTLVEIPKGSCAVYGSSFKAYTEDCANLNTYICMKRAV
NT seq 699 nt   +upstreamnt  +downstreamnt
atggcattgattcgtgatcgaaagtctcatcactcagagatgagcaaatgccataattac
gacctcaagccagcaaagtgggatacttctcaagaacaacagaaacaaagattagcacta
actaccagtcaacctggagaaaatggtatcataagaggaagataccctatagaaaaactc
aaaatatctccaatgttcgttgttcgagtccttgctatagccttggcaattcgattcacc
cttaacacattgatgtggcttgccattttcaaagagacgtttcagccagtattgtgcaac
aaggaagtcccagtttcctcaagagagggctactgtggcccatgccctaacaactggata
tgtcacagaaacaactgttaccaattttttaatgaagagaaaacctggaaccagagccaa
gcttcctgtttgtctcaaaattccagccttctgaagatatacagtaaagaagaacaggat
ttcttaaagctggttaagtcctatcactggatgggactggtccagatcccagcaaatggc
tcctggcagtgggaagatggctcctctctctcatacaatcagttaactctggtggaaata
ccaaaaggatcctgtgctgtctatggctcaagctttaaggcttacacagaagactgtgca
aatctaaacacgtacatctgcatgaaaagggcggtgtaa

KEGG   Mus musculus (house mouse): 80782
Entry
80782             CDS       T01002                                 
Symbol
Klrb1b, Klrb1d, Ly55b, Ly55d, NKR-P1B, NKR-P1D, Nkrp1-b, Nkrp1b, Nkrp1d, ly-55b, ly-55d
Name
(RefSeq) killer cell lectin-like receptor subfamily B member 1B
  KO
K06543  killer cell lectin-like receptor subfamily B
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05144  Malaria
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    80782 (Klrb1b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    80782 (Klrb1b)
   04091 Lectins [BR:mmu04091]
    80782 (Klrb1b)
CD molecules [BR:mmu04090]
 Proteins
  80782 (Klrb1b)
Lectins [BR:mmu04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   80782 (Klrb1b)
SSDB
Motif
Pfam: Lectin_C
Other DBs
NCBI-GeneID: 80782
NCBI-ProteinID: NP_085102
MGI: 107539
Ensembl: ENSMUSG00000079298
UniProt: Q99JB4 A0A1U9W1A4
Structure
LinkDB
Position
6:complement(128790669..128803278)
AA seq 223 aa
MDSTTLVYADLNLARIQEPKHDSPPSLSPDTCRCPRWHRLALKFGCAGLILLVLVVIGLC
VLVLSVQKSSVQKICADVQENRTHTTGCSAKLECPQDWLSHRDKCFHVSQVSNTWKECRI
DCDKKGATLLLIQDQEELRFLLDSIKEKYNSFWIGLSYTLTDMNWKWINGTAFNSDVLKI
TGVTENGSCAAISGEKVTSEGCSSDNRWICQKELNHETPCNDS
NT seq 672 nt   +upstreamnt  +downstreamnt
atggattcaacaacactggtctatgcagatttaaacctagccaggatccaagaacctaag
catgattcacctccatctctttccccagacacctgtcggtgccctcgctggcatcggttg
gctctgaaatttggctgtgctggcctcatccttcttgtgctggtcgtgattggactctgt
gtcttggtgctatcagtacaaaaatcatcagtacaaaaaatctgcgcggatgttcaagag
aacagaacacatacaacaggttgttcagctaagctagagtgcccacaagactggctttca
caccgagataagtgctttcacgtttctcaagtttccaacacttggaaggaatgtcgaatt
gattgtgataaaaaaggagccactttgctgctcattcaagaccaagaagaactgagattc
ctactggactcaataaaggaaaaatacaattcattttggattggactaagttacacatta
acagacatgaactggaagtggataaatggcacagctttcaattctgatgtactaaaaatc
actggtgtcactgaaaatggcagctgtgccgccatctcaggagaaaaagtgacttctgag
ggctgttcttcagacaaccgttggatctgccaaaaggaactaaaccatgaaaccccgtgt
aatgactcctga

DBGET integrated database retrieval system