KEGG   Mus musculus (house mouse): 100503605
Entry
100503605         CDS       T01002                                 
Symbol
Hbb-bs, Beta-s, Hbbt1, Hbbt2
Name
(RefSeq) hemoglobin, beta adult s chain
  KO
K13823  hemoglobin subunit beta
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05143  African trypanosomiasis
mmu05144  Malaria
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    100503605 (Hbb-bs)
   05143 African trypanosomiasis
    100503605 (Hbb-bs)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    100503605 (Hbb-bs)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    100503605 (Hbb-bs)
SSDB
Motif
Pfam: Globin Glycogen_syn
Other DBs
NCBI-GeneID: 100503605
NCBI-ProteinID: NP_001188320
MGI: 5474852
Ensembl: ENSMUSG00000052305
UniProt: P02088 A8DUK4
Structure
LinkDB
Position
7:complement(103475730..103477135)
AA seq 147 aa
MVHLTDAEKAAVSGLWGKVNADEVGGEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNAK
VKAHGKKVITAFNDGLNHLDSLKGTFASLSELHCDKLHVDPENFRLLGNMIVIVLGHHLG
KDFTPAAQAAFQKVVAGVAAALAHKYH
NT seq 444 nt   +upstreamnt  +downstreamnt
atggtgcacctgactgatgctgagaaggctgctgtctctggcctgtggggaaaggtgaac
gccgatgaagttggtggtgaggccctgggcaggctgctggttgtctacccttggacccag
cggtactttgatagctttggagacctatcctctgcctctgctatcatgggtaatgccaaa
gtgaaggcccatggcaagaaagtgataactgcctttaacgatggcctgaatcacttggac
agcctcaagggcacctttgccagcctcagtgagctccactgtgacaagctgcatgtggat
cctgagaacttcaggctcctgggcaatatgatcgtgattgtgctgggccaccacctgggc
aaggatttcacccccgctgcacaggctgccttccagaaggtggtggctggagtggccgct
gccctggctcacaagtaccactaa

KEGG   Mus musculus (house mouse): 101488143
Entry
101488143         CDS       T01002                                 
Symbol
Hbb-bt, Beta-t
Name
(RefSeq) hemoglobin, beta adult t chain
  KO
K13823  hemoglobin subunit beta
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05143  African trypanosomiasis
mmu05144  Malaria
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    101488143 (Hbb-bt)
   05143 African trypanosomiasis
    101488143 (Hbb-bt)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    101488143 (Hbb-bt)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    101488143 (Hbb-bt)
SSDB
Motif
Pfam: Globin Glycogen_syn
Other DBs
NCBI-GeneID: 101488143
NCBI-ProteinID: NP_032246
MGI: 5474850
Ensembl: ENSMUSG00000073940
UniProt: P02088 A8DUK4
Structure
LinkDB
Position
7:complement(103461731..103463130)
AA seq 147 aa
MVHLTDAEKAAVSGLWGKVNADEVGGEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNAK
VKAHGKKVITAFNDGLNHLDSLKGTFASLSELHCDKLHVDPENFRLLGNMIVIVLGHHLG
KDFTPAAQAAFQKVVAGVAAALAHKYH
NT seq 444 nt   +upstreamnt  +downstreamnt
atggtgcacctgactgatgctgagaaggctgctgtctctggcctgtggggaaaggtgaac
gccgatgaagttggtggtgaggccctgggcaggctgctggttgtctacccttggacccag
cggtactttgatagctttggagacctatcctctgcctctgctatcatgggtaatgccaaa
gtgaaggcccatggcaagaaagtgataactgcctttaacgatggcctgaatcacttggac
agcctcaagggcacctttgccagcctcagtgagctccactgtgacaagctgcatgtggat
cctgagaacttcaggctcctgggcaatatgatcgtgattgtgctgggccaccacctgggc
aaggatttcacccccgctgcacaggctgccttccagaaggtggtggctggagtggctgct
gccctggctcacaagtaccactaa

KEGG   Mus musculus (house mouse): 110257
Entry
110257            CDS       T01002                                 
Symbol
Hba-a2
Name
(RefSeq) hemoglobin alpha, adult chain 2
  KO
K13822  hemoglobin subunit alpha
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05143  African trypanosomiasis
mmu05144  Malaria
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    110257 (Hba-a2)
   05143 African trypanosomiasis
    110257 (Hba-a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    110257 (Hba-a2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   110257 (Hba-a2)
SSDB
Motif
Pfam: Globin Kiaa1109_N
Other DBs
NCBI-GeneID: 110257
NCBI-ProteinID: NP_001077424
MGI: 96016
Ensembl: ENSMUSG00000069917
UniProt: Q91VB8
LinkDB
Position
11:32246492..32247310
AA seq 142 aa
MVLSGEDKSNIKAAWGKIGGHGAEYGAEALERMFASFPTTKTYFPHFDVSHGSAQVKGHG
KKVADALANAAGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPADFTP
AVHASLDKFLASVSTVLTSKYR
NT seq 429 nt   +upstreamnt  +downstreamnt
atggtgctctctggggaagacaaaagcaacatcaaggctgcctgggggaagattggtggc
catggtgctgaatatggagctgaagccctggaaaggatgtttgctagcttccccaccacc
aagacctacttccctcactttgatgtaagccacggctctgcccaggtcaagggtcacggc
aagaaggtcgccgatgctctggccaatgctgcaggccacctcgatgacctgcccggtgcc
ctgtctgctctgagcgacctgcatgcccacaagctgcgtgtggatcccgtcaacttcaag
ctcctgagccactgcctgctggtgaccttggctagccaccaccctgccgatttcaccccc
gcggtgcatgcctctctggataaattccttgcctctgtgagcaccgtgctgacctccaag
taccgttaa

KEGG   Mus musculus (house mouse): 15122
Entry
15122             CDS       T01002                                 
Symbol
Hba-a1, Hba, Hba1, Hbat1
Name
(RefSeq) hemoglobin alpha, adult chain 1
  KO
K13822  hemoglobin subunit alpha
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05143  African trypanosomiasis
mmu05144  Malaria
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    15122 (Hba-a1)
   05143 African trypanosomiasis
    15122 (Hba-a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    15122 (Hba-a1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   15122 (Hba-a1)
SSDB
Motif
Pfam: Globin Kiaa1109_N
Other DBs
NCBI-GeneID: 15122
NCBI-ProteinID: NP_032244
MGI: 96015
Ensembl: ENSMUSG00000069919
UniProt: Q91VB8
LinkDB
Position
11:32233672..32234486
AA seq 142 aa
MVLSGEDKSNIKAAWGKIGGHGAEYGAEALERMFASFPTTKTYFPHFDVSHGSAQVKGHG
KKVADALANAAGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPADFTP
AVHASLDKFLASVSTVLTSKYR
NT seq 429 nt   +upstreamnt  +downstreamnt
atggtgctctctggggaagacaaaagcaacatcaaggctgcctgggggaagattggtggc
catggtgctgaatatggagctgaagccctggaaaggatgtttgctagcttccccaccacc
aagacctacttccctcactttgatgtaagccacggctctgcccaggtcaagggtcacggc
aagaaggtcgccgatgctctggccaatgctgcaggccacctcgatgacctgcccggtgcc
ctgtctgctctgagcgacctgcatgcccacaagctgcgtgtggatcccgtcaacttcaag
ctcctgagccactgcctgctggtgaccttggctagccaccaccctgccgatttcaccccc
gcggtgcatgcctctctggacaaattccttgcctctgtgagcaccgtgctgacctccaag
taccgttaa

KEGG   Mus musculus (house mouse): 15129
Entry
15129             CDS       T01002                                 
Symbol
Hbb-b1, AA409645, Hbb1, Hbbt1, Hbbt2, MommeD7, beta1
Name
(RefSeq) hemoglobin, beta adult major chain
  KO
K13823  hemoglobin subunit beta
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05143  African trypanosomiasis
mmu05144  Malaria
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    15129 (Hbb-b1)
   05143 African trypanosomiasis
    15129 (Hbb-b1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    15129 (Hbb-b1)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    15129 (Hbb-b1)
SSDB
Motif
Pfam: Globin Glycogen_syn
Other DBs
NCBI-GeneID: 15129
NCBI-ProteinID: NP_001265090
MGI: 96021
UniProt: P02088 A8DUK0
Structure
LinkDB
Position
7 E3; 7 54.85 cM
AA seq 147 aa
MVHLTDAEKAAVSCLWGKVNSDEVGGEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNAK
VKAHGKKVITAFNDGLNHLDSLKGTFASLSELHCDKLHVDPENFRLLGNMIVIVLGHHLG
KDFTPAAQAAFQKVVAGVATALAHKYH
NT seq 444 nt   +upstreamnt  +downstreamnt
atggtgcacctgactgatgctgagaaggctgctgtctcttgcctgtggggaaaggtgaac
tccgatgaagttggtggtgaggccctgggcaggctgctggttgtctacccttggacccag
cggtactttgatagctttggagacctatcctctgcctctgctatcatgggtaatgccaaa
gtgaaggcccatggcaagaaggtgataactgcctttaacgatggcctgaatcacttggac
agcctcaagggcacctttgccagcctcagtgagctccactgtgacaagctgcatgtggat
cctgagaacttcaggctcctgggcaatatgatcgtgattgtgctgggccaccacctgggc
aaggatttcacccccgctgcacaggctgccttccagaaggtggtggctggagtggccact
gccctggctcacaagtaccactaa

KEGG   Mus musculus (house mouse): 15130
Entry
15130             CDS       T01002                                 
Symbol
Hbb-b2, AI036344, Hbb2, Hbbt2, beta2
Name
(RefSeq) hemoglobin, beta adult minor chain
  KO
K13823  hemoglobin subunit beta
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05143  African trypanosomiasis
mmu05144  Malaria
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    15130 (Hbb-b2)
   05143 African trypanosomiasis
    15130 (Hbb-b2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    15130 (Hbb-b2)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    15130 (Hbb-b2)
SSDB
Motif
Pfam: Globin
Other DBs
NCBI-GeneID: 15130
NCBI-ProteinID: NP_058652
MGI: 96022
UniProt: P02089 Q549D9
Structure
LinkDB
Position
7 E3; 7 54.85 cM
AA seq 147 aa
MVHLTDAEKSAVSCLWAKVNPDEVGGEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNPK
VKAHGKKVITAFNEGLKNLDNLKGTFASLSELHCDKLHVDPENFRLLGNAIVIVLGHHLG
KDFTPAAQAAFQKVVAGVATALAHKYH
NT seq 444 nt   +upstreamnt  +downstreamnt
atggtgcacctgactgatgctgagaagtctgctgtctcttgcctgtgggcaaaggtgaac
cccgatgaagttggtggtgaggccctgggcaggctgctggttgtctacccttggacccag
cggtactttgatagctttggagacctatcctctgcctctgctatcatgggtaatcccaag
gtgaaggcccatggcaaaaaggtgataactgcctttaacgagggcctgaaaaacctggac
aacctcaagggcacctttgccagcctcagtgagctccactgtgacaagctgcatgtggat
cctgagaacttcaggctcctaggcaatgcgatcgtgattgtgctgggccaccacctgggc
aaggatttcacccctgctgcacaggctgccttccagaaggtggtggctggagtggccact
gccctggctcacaagtaccactaa

KEGG   Mus musculus (house mouse): 436003
Entry
436003            CDS       T01002                                 
Symbol
Hbb-bh2, EG436003, Gm5736
Name
(RefSeq) hemoglobin beta, bh2
  KO
K13823  hemoglobin subunit beta
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05143  African trypanosomiasis
mmu05144  Malaria
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    436003 (Hbb-bh2)
   05143 African trypanosomiasis
    436003 (Hbb-bh2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    436003 (Hbb-bh2)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    436003 (Hbb-bh2)
SSDB
Motif
Pfam: Globin
Other DBs
NCBI-GeneID: 436003
NCBI-ProteinID: NP_001121158
MGI: 96025
Ensembl: ENSMUSG00000078621
UniProt: B2RVB7
LinkDB
Position
7:complement(103488008..103490418)
AA seq 147 aa
MVELTAEEKAAITATWTKVKAEELGVESLERILTVYPHTKRYFDHFGDFSFCAATEDNHK
LKALGKKMIESFSEDLQSLDNLHYTFASLSELHHDKLHMDPENFKLLGSMIVIVMSPHFG
NSFTSALQAAFEKVVAAVADAMAYKYY
NT seq 444 nt   +upstreamnt  +downstreamnt
atggtggagctcactgcagaggagaaggcagccatcactgccacgtggactaaggtgaag
gcagaagaacttggtgttgagtccctggaaagaatactgacggtttatccacacaccaag
agatactttgaccactttggagacttctccttctgtgctgccactgaagataaccacaag
ctgaaggctcttggtaagaagatgatagaatcctttagtgaggacctgcaatccctggac
aacctgcactacacctttgccagcctgagtgagctgcaccatgacaagcttcatatggat
cctgagaacttcaagctcctgggcagcatgatagtgattgtgatgtctccacactttggc
aacagctttacttcagcactgcaagctgcttttgagaaggtggtggctgctgttgcagat
gctatggcttacaagtattactga

DBGET integrated database retrieval system