KEGG   Mus musculus (house mouse): 101056240
Entry
101056240         CDS       T01002                                 
Symbol
Gm13430
Name
(RefSeq) predicted gene 13430
  KO
K12160  small ubiquitin-related modifier
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03013  Nucleocytoplasmic transport
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    101056240 (Gm13430)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101056240 (Gm13430)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    101056240 (Gm13430)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    101056240 (Gm13430)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    101056240 (Gm13430)
Ubiquitin system [BR:mmu04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   101056240 (Gm13430)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    101056240 (Gm13430)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septin associated proteins
    101056240 (Gm13430)
SSDB
Motif
Pfam: Rad60-SLD ubiquitin DUF4984 DUF5010_C
Other DBs
NCBI-GeneID: 101056240
NCBI-ProteinID: XP_036018666
MGI: 3651032
LinkDB
Position
2:36279144..36280045
AA seq 95 aa
MANKKPKEGVKTENNNHIILKGVGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSTRQIRF
RFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY
NT seq 288 nt   +upstreamnt  +downstreamnt
atggccaacaagaaacccaaggaaggagtcaagactgagaacaacaatcatattattttg
aagggggtgggacaggatggttctgtggtgcagtttaagattaagaggcatacaccactt
agtaaactaatgaaagcctattgtgaacggcagggtttgtcaacgaggcagatcagattc
cggtttgatgggcagccaatcaacgaaacagacacacctgcacagttggaaatggaggat
gaagatacgattgatgtgttccagcagcagactggaggtgtctactaa

KEGG   Mus musculus (house mouse): 102640040
Entry
102640040         CDS       T01002                                 
Symbol
Gm11971
Name
(RefSeq) predicted gene 11971
  KO
K12160  small ubiquitin-related modifier
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03013  Nucleocytoplasmic transport
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    102640040 (Gm11971)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102640040 (Gm11971)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    102640040 (Gm11971)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    102640040 (Gm11971)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    102640040 (Gm11971)
Ubiquitin system [BR:mmu04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   102640040 (Gm11971)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    102640040 (Gm11971)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septin associated proteins
    102640040 (Gm11971)
SSDB
Motif
Pfam: Rad60-SLD ubiquitin
Other DBs
NCBI-GeneID: 102640040
NCBI-ProteinID: XP_036013016
MGI: 3650054
LinkDB
Position
11:6403136..6403613
AA seq 95 aa
MANEKPKEGDKTENNDHIHLKVAGQDGSVVQFKIKRHTPLSKLMKAHCEWQGLSMRQIRF
QFDGQPINETDTPAQLEMEDEDTTDVFQQQTGGVY
NT seq 288 nt   +upstreamnt  +downstreamnt
atggccaacgagaaacccaaggaaggagacaagactgagaacaacgatcatattcatttg
aaggtggcaggacaggatggttctgtggtgcagtttaagattaagaggcatacaccactt
agtaaactaatgaaagcccattgtgaatggcagggtttgtcaatgaggcagatcagattc
cagtttgatgggcagccaatcaatgaaacagacacacctgcacagctggaaatggaggat
gaagatacgactgatgtgttccagcagcagactggaggtgtctactaa

KEGG   Mus musculus (house mouse): 170930
Entry
170930            CDS       T01002                                 
Symbol
Sumo2, SUMO-2, Smt3A, Smt3b, Smt3h2
Name
(RefSeq) small ubiquitin-like modifier 2
  KO
K12160  small ubiquitin-related modifier
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03013  Nucleocytoplasmic transport
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    170930 (Sumo2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    170930 (Sumo2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    170930 (Sumo2)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    170930 (Sumo2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    170930 (Sumo2)
Ubiquitin system [BR:mmu04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   170930 (Sumo2)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    170930 (Sumo2)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septin associated proteins
    170930 (Sumo2)
SSDB
Motif
Pfam: Rad60-SLD ubiquitin DUF5010_C
Other DBs
NCBI-GeneID: 170930
NCBI-ProteinID: NP_579932
MGI: 2158813
Ensembl: ENSMUSG00000020738
UniProt: P61957
Structure
LinkDB
Position
11:complement(115413935..115427056)
AA seq 95 aa
MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRF
RFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY
NT seq 288 nt   +upstreamnt  +downstreamnt
atggccgacgagaaacccaaggaaggagtcaagactgagaacaacgatcatattaatttg
aaggtggcgggacaggatggttctgtggtgcagtttaagattaagaggcatacaccactt
agtaaactaatgaaagcctattgtgaacggcagggtttgtcaatgaggcagatcagattc
cggtttgatgggcagccaatcaacgaaacagacacacctgcacagttggaaatggaggat
gaagatacgattgatgtgttccagcagcagactggaggtgtctactaa

KEGG   Mus musculus (house mouse): 20610
Entry
20610             CDS       T01002                                 
Symbol
Sumo3, 2810014B19Rik, D10Ertd345e, SMT3A, SUMO-3, Smt3h1
Name
(RefSeq) small ubiquitin-like modifier 3
  KO
K12160  small ubiquitin-related modifier
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03013  Nucleocytoplasmic transport
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    20610 (Sumo3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    20610 (Sumo3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    20610 (Sumo3)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    20610 (Sumo3)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    20610 (Sumo3)
Ubiquitin system [BR:mmu04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   20610 (Sumo3)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    20610 (Sumo3)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septin associated proteins
    20610 (Sumo3)
SSDB
Motif
Pfam: Rad60-SLD ubiquitin DUF5010_C
Other DBs
NCBI-GeneID: 20610
NCBI-ProteinID: NP_001288600
MGI: 1336201
Ensembl: ENSMUSG00000020265
UniProt: Q9Z172
LinkDB
Position
10:77441931..77454165
AA seq 110 aa
MTTVLAQEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFR
FDGQPINETDTPAQLEMEDEDTIDVFQQQTGGSASRGSVPTPNRCPDLCY
NT seq 333 nt   +upstreamnt  +downstreamnt
atgaccactgtgttggctcaggagggtgtgaagacagagaatgaccacatcaacctgaaa
gtggcggggcaggatggctcggtggtacagttcaagatcaagaggcacaccccactgagc
aagctgatgaaggcctactgtgagaggcagggcttgtcaatgaggcagattcgattccgg
tttgatggacaaccaatcaatgaaacagacactccagcccagctggagatggaggatgag
gacaccattgatgtattccagcagcagacaggaggatcagcctcccgagggagcgtcccc
acacccaaccgttgtcctgacctgtgctattga

KEGG   Mus musculus (house mouse): 22218
Entry
22218             CDS       T01002                                 
Symbol
Sumo1, GMP1, PIC1, SENTRIN, SMT3, SMT3H3, SMTP3, SUMO-1, Smt3C, Ubl1
Name
(RefSeq) small ubiquitin-like modifier 1
  KO
K12160  small ubiquitin-related modifier
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03013  Nucleocytoplasmic transport
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    22218 (Sumo1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    22218 (Sumo1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    22218 (Sumo1)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    22218 (Sumo1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    22218 (Sumo1)
Ubiquitin system [BR:mmu04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   22218 (Sumo1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    22218 (Sumo1)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septin associated proteins
    22218 (Sumo1)
SSDB
Motif
Pfam: Rad60-SLD ubiquitin
Other DBs
NCBI-GeneID: 22218
NCBI-ProteinID: NP_033486
MGI: 1197010
Ensembl: ENSMUSG00000026021
UniProt: P63166
LinkDB
Position
1:complement(59678593..59709993)
AA seq 101 aa
MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMN
SLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV
NT seq 306 nt   +upstreamnt  +downstreamnt
atgtctgaccaggaggcaaaaccttcaactgaggacttaggcgataagaaggaaggagaa
tacattaaactcaaagttattggacaggatagcagtgagatacatttcaaagtgaaaatg
acaacacatctcaagaaactcaaagaatcatactgtcaaagacagggagttccaatgaat
tcactcaggtttctctttgaaggtcagagaattgctgataatcatactccgaaagaactg
ggaatggaggaagaagatgtgattgaagtttatcaggaacaaacggggggtcactcgacg
gtttag

DBGET integrated database retrieval system