KEGG   Mus musculus (house mouse): 102657
Entry
102657            CDS       T01002                                 
Symbol
Cd276, 6030411F23Rik, AU016588, B7RP-2, B7h3
Name
(RefSeq) CD276 antigen
  KO
K06746  immune costimulatory protein B7-H3
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102657 (Cd276)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    102657 (Cd276)
CD molecules [BR:mmu04090]
 Proteins
  102657 (Cd276)
SSDB
Motif
Pfam: Ig_3 ig V-set Ig_2 I-set C2-set_2 C1-set
Other DBs
NCBI-GeneID: 102657
NCBI-ProteinID: NP_598744
MGI: 2183926
Ensembl: ENSMUSG00000035914
UniProt: Q8VE98 A6MDC5
Structure
LinkDB
Position
9:complement(58431583..58462316)
AA seq 316 aa
MLRGWGGPSVGVCVRTALGVLCLCLTGAVEVQVSEDPVVALVDTDATLRCSFSPEPGFSL
AQLNLIWQLTDTKQLVHSFTEGRDQGSAYSNRTALFPDLLVQGNASLRLQRVRVTDEGSY
TCFVSIQDFDSAAVSLQVAAPYSKPSMTLEPNKDLRPGNMVTITCSSYQGYPEAEVFWKD
GQGVPLTGNVTTSQMANERGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQ
PLTFPPEALWVTVGLSVCLVVLLVALAFVCWRKIKQSCEEENAGAEDQDGDGEGSKTALR
PLKPSENKEDDGQEIA
NT seq 951 nt   +upstreamnt  +downstreamnt
atgcttcgaggatggggtggccccagtgtgggtgtgtgtgtgcgcacagcactgggggtg
ctgtgcctctgcctcacaggagctgtggaagtccaggtctctgaagaccccgtggtggcc
ctggtggacacggatgccaccctacgctgctccttttccccagagcctggcttcagtctg
gcacagctcaacctcatctggcagctgacagacaccaaacagctggtgcacagcttcacg
gagggccgggaccaaggcagtgcctactccaaccgcacagcgctcttccctgacctgttg
gtgcaaggcaatgcgtccttgaggctgcagcgcgtccgagtaaccgacgagggcagctac
acctgctttgtgagcatccaggactttgacagcgctgctgttagcctgcaggtggccgcc
ccctactcgaagcccagcatgaccctggagcccaacaaggacctacgtccagggaacatg
gtgaccatcacgtgctctagctaccagggctatccggaggccgaggtgttctggaaggat
ggacagggagtgcccttgactggcaatgtgaccacatcccagatggccaacgagcggggc
ttgttcgatgttcacagcgtgctgagggtggtgctgggtgctaacggcacctacagctgc
ctggtacgcaacccggtgttgcagcaagatgctcacggctcagtcaccatcacagggcag
cccctgacattcccccctgaggctctgtgggtaaccgtggggctctctgtctgtcttgtg
gtactactggtggccctggctttcgtgtgctggagaaagatcaagcagagctgcgaggag
gagaatgcaggtgccgaggaccaggatggagatggagaaggatccaagacagctctacgg
cctctgaaaccctctgaaaacaaagaagatgacggacaagaaattgcttga

DBGET integrated database retrieval system