KEGG   Mus musculus (house mouse): 104318
Entry
104318            CDS       T01002                                 
Symbol
Csnk1d, 1200006A05Rik, AA409348, D930010H05Rik
Name
(RefSeq) casein kinase 1, delta
  KO
K08959  casein kinase 1, delta [EC:2.7.11.1]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04340  Hedgehog signaling pathway
mmu04390  Hippo signaling pathway
mmu04540  Gap junction
mmu04710  Circadian rhythm
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    104318 (Csnk1d)
   04390 Hippo signaling pathway
    104318 (Csnk1d)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104318 (Csnk1d)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    104318 (Csnk1d)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    104318 (Csnk1d)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    104318 (Csnk1d)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104318 (Csnk1d)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   104318 (Csnk1d)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation proteins
   Kinases and associated factors
    104318 (Csnk1d)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH Pox_ser-thr_kin
Other DBs
NCBI-GeneID: 104318
NCBI-ProteinID: NP_620690
MGI: 1355272
Ensembl: ENSMUSG00000025162
UniProt: Q9DC28
Structure
LinkDB
Position
11:complement(120848535..120882180)
AA seq 415 aa
MELRVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQ
GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGASRA
ADDAERERRDREERLRHSRNPATRGLPSTASGRLRGTQEVAPPTPLTPTSHTANTSPRPV
SGMERERKVSMRLHRGAPVNVSSSDLTGRQDTSRMSTSQIPGRVASSGLQSVVHR
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggagctgagggtcgggaacaggtaccgactgggccgcaagatcggcagcggctccttc
ggagacatctatctcggtacggacattgctgcgggagaagaagttgccatcaagcttgaa
tgtgtcaaaaccaaacatcctcagctccacattgagagcaagatctacaaaatgatgcag
ggaggagtgggcatccctaccatcagatggtgtggggctgagggggactacaatgtcatg
gtgatggagctactgggacccagcctggaagacctgttcaacttctgttcaaggaagttt
agtctcaaaactgttctgttgcttgctgaccaaatgataagtcgtattgagtacattcat
tcgaagaattttatccaccgagatgtgaagccagataacttcctcatggggctgggaaag
aaaggcaacctggtctacatcattgactttgggctggccaagaagtatcgggatgcacgc
acccaccagcatatcccctatcgagagaacaagaacctcacagggacagcacgctatgcc
tccatcaacacgcaccttggcattgaacaatctcgaagggatgacttggagtctctgggg
tacgtgctgatgtacttcaacctgggctctctcccctggcaggggctgaaggccgccacc
aagaggcagaagtatgagaggatcagtgagaagaagatgtccactcccattgaagtgctg
tgcaagggctatccttctgaatttgccacatacctgaatttctgccgttccttacgtttt
gatgacaaacctgactactcctacctgagacagctcttcagaaatctgttccatcgccaa
ggcttctcctacgactatgtgttcgactggaacatgctcaaatttggtgccagccgggct
gcagatgatgctgagcgggaacgccgggatcgagaagaacgattaagacactcccggaat
ccagccactcgtggcctcccttctacagcttccggccgtctgcggggaacccaggaagtg
gctcccccaacgccccttacccctacctcacacacggccaacacctctccgaggcctgtc
tctggcatggaacgagaacggaaagtgagtatgcggctgcaccgtggggccccagtcaac
gtctcctcatctgatctcacgggccgacaagatacctctcgcatgtccacctcacagatt
cccggtcgggtggcttccagtggtcttcagtctgtcgtgcaccgatga

KEGG   Mus musculus (house mouse): 27373
Entry
27373             CDS       T01002                                 
Symbol
Csnk1e, AI426939, AI551861, AW457082, CK1epsilon, CKIe, KC1epsilon, tau
Name
(RefSeq) casein kinase 1, epsilon
  KO
K08960  casein kinase 1, epsilon [EC:2.7.11.1]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04068  FoxO signaling pathway
mmu04310  Wnt signaling pathway
mmu04340  Hedgehog signaling pathway
mmu04390  Hippo signaling pathway
mmu04392  Hippo signaling pathway - multiple species
mmu04710  Circadian rhythm
mmu05010  Alzheimer disease
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    27373 (Csnk1e)
   04340 Hedgehog signaling pathway
    27373 (Csnk1e)
   04390 Hippo signaling pathway
    27373 (Csnk1e)
   04392 Hippo signaling pathway - multiple species
    27373 (Csnk1e)
   04068 FoxO signaling pathway
    27373 (Csnk1e)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    27373 (Csnk1e)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    27373 (Csnk1e)
   05022 Pathways of neurodegeneration - multiple diseases
    27373 (Csnk1e)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    27373 (Csnk1e)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    27373 (Csnk1e)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     27373 (Csnk1e)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   27373 (Csnk1e)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation proteins
   Kinases and associated factors
    27373 (Csnk1e)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal ABC1 APH Pox_ser-thr_kin Kdo
Other DBs
NCBI-GeneID: 27373
NCBI-ProteinID: NP_001276827
MGI: 1351660
Ensembl: ENSMUSG00000022433
UniProt: Q9JMK2
LinkDB
Position
15:complement(79302052..79339779)
AA seq 416 aa
MELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLHIESKFYKMMQ
GGVGIPSIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGAARN
PEDVDRERREHEREERMGQLRGSATRALPPGPPTGATANRLRSAAEPVASTPASRIQQTG
NTSPRAISRADRERKVSMRLHRGAPANVSSSDLTGRQEVSRLAASQTSVPFDHLGK
NT seq 1251 nt   +upstreamnt  +downstreamnt
atggagttgcgtgtgggaaataagtatcgcctgggccgaaagatcggcagtggctccttt
ggagacatctacctgggtgccaacattgcctctggtgaggaagtagccatcaagctcgaa
tgtgtgaagacgaaacatccccagctccacatcgagagcaagttctacaagatgatgcag
ggcggagtggggatcccgtccatcaagtggtgcggggctgagggagactataacgtgatg
gtcatggagctgctggggcccagcctggaggacctcttcaacttctgttcccggaagttc
agcctcaagacggtgctgttgctggccgaccagatgatcagccgcatcgagtacatacac
tccaagaacttcatccaccgggatgtgaagcccgacaacttcctcatgggcctggggaag
aaaggcaacctggtgtacatcattgacttcggcctggccaagaagtaccgcgatgcccgc
acacaccagcatattccctaccgggaaaacaagaacctgaccggcactgcccgctatgcc
tctatcaacacccacctgggcattgagcaaagccgtcgagatgacctagagagcttgggc
tatgtgctcatgtacttcaacctgggctccctgccctggcagggcctcaaagcagccacc
aagcgtcagaagtacgagcggattagcgagaagaagatgtcaacgccaatcgaggtcctc
tgcaaaggctacccctccgagttctcaacatacctcaacttctgccgctccctgcggttc
gatgataagcctgactactcctacctgcgccagctcttccgaaatctctttcaccggcag
ggtttctcctacgactacgtcttcgactggaacatgctcaaattcggtgcagcccggaat
cccgaggatgtagaccgggaaagacgggagcacgaacgggaagagaggatggggcagttg
cgagggtccgcgaccagagccctgccccctggcccacctacaggggctaccgccaaccga
ctccgaagtgcagccgagcctgtggcttccactccagcctcccgcatccaacaaactggc
aatacttctcccagagcgatctcacgggccgaccgagagaggaaggtgagcatgagactc
cacagaggtgcccctgccaatgtctcctcctcagacctcactgggcggcaagaggtctcc
cggcttgcagcctcacagacaagcgtgccatttgaccatcttgggaaatga

DBGET integrated database retrieval system