KEGG   Mus musculus (house mouse): 105988
Entry
105988            CDS       T01002                                 
Symbol
Espl1, AL024103, AU045071, Cerp, ESP1, PRCE, SSE
Name
(RefSeq) extra spindle pole bodies 1, separase
  KO
K02365  separase [EC:3.4.22.49]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    105988 (Espl1)
   04114 Oocyte meiosis
    105988 (Espl1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105988 (Espl1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    105988 (Espl1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    105988 (Espl1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.49  separase
     105988 (Espl1)
Peptidases and inhibitors [BR:mmu01002]
 Cysteine peptidases
  Family C50: separase family
   105988 (Espl1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Separase
    105988 (Espl1)
SSDB
Motif
Pfam: Peptidase_C50 CHAT
Other DBs
NCBI-GeneID: 105988
NCBI-ProteinID: NP_001014976
MGI: 2146156
Ensembl: ENSMUSG00000058290
UniProt: P60330
LinkDB
Position
15:102204688..102232792
AA seq 2118 aa
MRNFKGVNFATLLCSKEETQQLLPDLKEFLSRSRTDFPSSRTDAERRQICDTILRACTQQ
LTAKLDCPGHLRSILDLAELACDGYLLSTPQRPPLYLERILFILLRNGSTQGSPDTVLRL
AQPLHACLVQNSGEAAPQDYEAVTRGSFSLFWKGAEALLERRAAFSTRLNALSFLVLLED
GSVPCEVPHFASPTACRLVAAYQLYDATGQGLDEADADFLYEVLSRHLIRVLVGEGGSSP
GPLSPQRALCLLEITLEHCRRLCWNHHHRQAARAVERARNHLEKTSVAPSLQLCQMGVEL
LEAVEERPGAVAQLLRKAAAVLINSIEAPSPPLRALYDSCQFFLSGLERGIRRHCGLDAI
LSLFAFLGGYSSLVRHLREVSEASSKQQQCLLQMHFQGFHLFTGIVYDFAQGCQATELAQ
LVDGCRSAAVWMLEALEGLSGGELADYLSMTASYTSNLAYSFFSQKLYEEACVISEPVCQ
HLGSATSGACPEVPPEKLHRCFRLHVESLKKLGKQAQGCKMVTLWLAALKPYSLEHMVEP
VTFWVRVKMDASRAGDKELQLQTLRDSLSCWDPETQSLLLREELRAYKSVRADTGQERFN
IICDLLELSPEETAAGAWARATYLVELAQVLCYHNFTQQTNCSALDAVQEALQLLESVSP
EAQEQDRLLDDKAQALLWLYICTLEAKMQEGIERDRRAQAPSNLEEFEVNDLNYEDKLQE
DRFLYSSIAFNLAADAAQSKCLDQALTLWKEVLTKGRAPAVRCLQQTAASLQILAAVYQL
VAKPLQALETLLLLQIVSKRLQDHAKAASSSCQLTQLLLNLGCPSYAQLYLEEAESSLRS
LDQTSDACQLLSLTCALLGSQLCWACQKVTAGVSLLLSVLRDPALQKSSKAWYLLRVQAL
QVLAFYLSLSSNLLSSALREQLWDQGWQTPETALIDAHKLLRSIIILLMGSDVLSIQKAA
TESPFLDYGENLVQKWQVLTEVLTCSERLVGRLGRLGNVSEAKAFCLEALKLTTKLQIPR
QCALFLVLKGELELARGDIDLCQSDLQQVLFLLESSTEFGVVTQHPDSVKKVHTQKGKHK
AQGPCFPPLSEEEPFLKGPALELVDTVLNEPGPIQSSVNSSPVLKTKPPPNPGFLSHLPS
CDCLLCASPALSAVCLRWVLVTAGVRLATGHKAQGLDLLQAVLTRCPAATKRFTQSLQAS
LNHRTTPSCVPSLFDEIMAQVYTHLALEFLNQTSEKSLGKVLASGLKFVATRIQSLEIWR
AHLLLVQALAKLAHFSCCTSELFASSWGWHPPLVKSLPVLEPAKIRRQKCSGRGRRRIAS
VPPPLHNSSQKGLEEEGPPCTPKPPGRARQAGPRVPFTIFEEVHPTKSKLQVPLAPRVHR
RAQTRLKVIFSDDSDLEDLVSADTQLVEEPKRRGTASRTRGQTRKGRSLKTDAVVAIEST
PGHSSVSGRTRRARKVASRNCEEESPKAPLCVWASQGPEIMRSIPEEEPVDNHLEKSFEI
LRGSDGEDSASGEKAAAADTGLPVGECEVLRRDSSKAERPVLYSDTEANSDPSPWLPPFS
VPAPIDLSTLDSISDSLSIAFRGVSHCPPSGLYAHLCRFLALCLGHRDPYATAFLVAESI
SITCRHQLLTHLHRQLSKAQKQQESPELAEHLQRLDLKERPGGVPLARIQRLFSFKALGS
GCFPQAEKESFQERLALIPSGVTVCVLALATLQPGTLSNTLLLTRLEKDNPPITVKIPTA
QNKLPLSAVLKEFDAIQKDQKENSSCTEKRVWWTGRLALDQRMEALITALEEQVLGCWRG
LLLPCSADPSLAQEASKLQELLRECGWEYPDSTLLKVILSGARILTSQDVQALACGLCPA
QPDRAQVLLSEAVGQVQSQEAPRSQHLVLVLDKDLQKLPWESTPILQAQPVTRLPSFRFL
LSYTVTKEAGASSVLSQGVDPQNTFYVLNPHSNLSSTEERFRASFSSETGWKGVIGEVPS
LDQVQAALTERDLYIYAGHGAGARFLDGQAVLRLSCRAVALLFGCSSAALAVHGNLEGAG
IVLKYIMAGCPLFLGNLWDVTDRDIDRYTEALLQGWLGAGPGAPFLYYASQARQAPRLKY
LIGAAPVAYGLPISLQTP
NT seq 6357 nt   +upstreamnt  +downstreamnt
atgaggaacttcaaaggagtcaacttcgccactctgctctgcagcaaggaggagacccag
cagctgctgcctgacttgaaggagttcctgtccagatcccggactgatttccccagcagc
cgaacagatgccgaaagaagacaaatttgcgataccatcctgagggcttgcacccagcag
ttgactgccaagctcgattgccctgggcacctgaggagtattttggacctggcagagctg
gcctgtgatggctatttgttgtctactccacagcgccctcccctctacctggaacgcatt
ctcttcatcctacttcgcaatggttccactcagggaagcccagacactgtgctgcgcctt
gcccagcctctccatgcctgcttggttcagaactctggagaggctgcccctcaggactat
gaggccgtgacccggggcagcttctctctgttttggaagggagcagaggcactgttggag
cggcgagctgcgttctcaactcggctgaatgccttgagcttcttggtgctcttggaggat
ggcagtgtcccctgtgaggtccctcactttgcttctccaaccgcctgtcgtttagttgcc
gcctatcagctgtacgatgctacaggacaaggtctagatgaagctgatgccgacttcctg
tatgaagtgctttctaggcacctgatcagagtcttagtaggtgagggtggtagctctccc
ggtcctctctcgcctcagagggccctctgcctcttggaaatcaccctggaacactgccgt
cggctctgctggaaccaccaccaccgccaggctgccagagcagtggagagggctcgtaat
cacctagagaagaccagtgtagctcctagcctccagttatgccagatgggggttgagctg
ttggaagctgtagaagaaagaccaggggcagtggcccagcttctgaggaaggcagcagcc
gttcttatcaacagtatcgaggcgccgtcgcccccgctccgggcattgtacgacagctgc
cagttcttcctttcaggcctggagagaggcatcaggaggcactgtggacttgatgccata
ttgagtctctttgcttttcttgggggatacagctcccttgtccggcacctgagagaagtc
tctgaagcatcttccaagcagcagcagtgcttgcttcagatgcacttccagggtttccac
ctcttcaccgggattgtgtatgactttgctcaaggctgtcaggcaactgagcttgctcag
ctagtggacggttgcagatctgctgctgtctggatgttggaggccttagagggcctgtcg
ggtggagagctggctgactacctgagcatgactgcctcttacaccagcaacttggcctac
agcttctttagtcagaagctctatgaggaggcctgcgtcatctcagagccagtctgtcag
cacttgggctcggcaacgtcgggtgcttgtcctgaagtgcctcctgagaagctacatagg
tgcttcaggctgcatgtggagagtttgaagaaactgggtaaacaggcccagggctgcaag
atggtgaccttatggctggcagctctgaaaccctacagtctggaacacatggtcgagcca
gtcactttctgggttcgagtcaaaatggatgcatccagggcaggagacaaggagctacaa
cttcagactttgcgagacagcctaagctgctgggacccagagacacagtctctgcttctc
agggaggagctgcgggcctacaagtcagtacgggctgacactgggcaggagcgcttcaac
atcatctgtgatctgctcgagctgagccctgaagagacagcagctggagcctgggcacga
gctacctacctggtggaactggcccaagtgctgtgctaccacaactttacccagcagacc
aactgctctgccttggatgctgtccaggaagccctgcagcttctggagtccgtgagtcct
gaggcccaggagcaggatcgacttctggatgataaagcacaggccttgttatggctttac
atctgtaccttagaggccaagatgcaggaaggtattgagcgggatcggagagcccaggcc
cctagtaacttggaggaatttgaagtcaatgacctgaactatgaagataaactgcaggaa
gatcgttttctgtatagtagcattgccttcaatctggctgctgatgcagctcagtccaaa
tgcctggaccaggccctgactctgtggaaagaagtgctcaccaaggggcgagccccagct
gtgcggtgtctccagcagactgcagcctccctgcaaatcctagcggccgtctatcagttg
gtggcaaagcccttgcaggctctggagaccctcctgctcctgcagattgtatctaagaga
ctgcaggaccacgcaaaggcagccagctcttcctgccagcttacccagctactcttgaac
cttggctgtcccagctatgcgcagttgtatctggaagaggcggagtcaagcctgaggagc
ctggaccagacaagtgacgcgtgccagctgctgtccctgacctgtgctctgcttggaagt
cagctctgctgggcttgccagaaggtaactgcaggcgtttctttgttgctttctgtgctt
cgggatcctgccctccagaagtcatctaaggcttggtacttgctacgtgtccaggccctg
caagttctggctttttacctcagtctctcgtccaacctcctctcaagtgccctgcgtgag
cagctctgggatcaaggctggcagaccccggagacggcgctgattgatgcccacaagctc
ctcagaagcatcatcattctgctcatgggaagtgatgtgctctccattcagaaagcagcc
accgagtcgccctttctggactacggtgagaatctggtgcaaaaatggcaggttctcaca
gaggtgctgacctgctcggagaggctggtcggccgcctgggtcgcctggggaacgtgagt
gaggccaaggccttttgcttggaggccctaaaacttacgactaagctgcagatacctcga
cagtgtgccctgttccttgtactgaagggtgagctggagctggcccggggtgacattgac
ctctgtcagtcagacttgcagcaggttctcttcttgctcgagtcttccacagagtttggt
gttgtgacccagcatccagactcagtgaagaaggtgcacacgcagaaagggaagcataag
gctcaaggcccatgtttcccacccctgtcagaggaggagcccttcctgaaaggtcctgcc
cttgagctggtggacactgtgctcaacgaacctggtcccatccagtcctctgtaaactcc
tccccagtcctgaaaaccaagccaccacccaaccctggcttcctgtctcacttgcccagc
tgtgactgcttactgtgtgccagccctgccctctcagcagtctgtctgcgctgggtgctg
gtcactgccggagtgaggctggccaccggtcacaaagctcagggtctggatctgctgcaa
gctgtgctgacgcgttgccctgcagccaccaagcgcttcacacagagtctccaagcttct
ctgaatcacagaacaaccccctcttgtgttcccagcctctttgatgagatcatggctcaa
gtgtacacgcacttggcattggagttcctgaatcagacatctgaaaagagcctggggaag
gtcctggcgtcggggctgaagtttgtggcaacacggatacagagcttggagatctggaga
gcccacctgctcttggttcaggcccttgcaaagctggcccacttcagctgctgtacttcc
gaactctttgcaagctcctggggctggcacccaccattagtaaaaagtctgccagtctta
gagcctgctaaaattcggagacaaaaatgctctggacggggccgccggcggatagcctct
gttcccccacccctccataacagctctcagaaaggtctggaagaggaagggccaccttgt
acccctaagcctccaggtcgggctaggcaagctggccctcgtgtccctttcaccatattt
gaagaagtccaccccaccaagagcaagctccaggttcccttggctcccagggtccacagg
cgggcccagactcgcctcaaggtgatcttcagtgatgacagtgacctggaagaccttgtc
tcagctgacacacaacttgtagaggagcctaagaggcgagggactgcttcccgtacccgg
ggccaaactaggaagggacgtagcttaaagacagatgcggtggttgctatagaaagtacc
cctggacattccagtgtcagtgggaggactcggagggccaggaaggtggcttcaagaaat
tgtgaagaagagagtcccaaagcacccctctgtgtctgggccagccagggacccgagatc
atgagaagtatccctgaagaggagccagtggacaaccatctggaaaaaagcttcgagatt
ctcaggggttctgatggggaagactcggcctcaggtgagaaggcggcagctgcagacact
ggtctacccgtaggagagtgtgaggtgttgagacgggactccagcaaggcagagagacct
gtcttgtactcagacacggaggccaatagtgaccctagtccttggctcccacccttctca
gttcctgcacccattgatctttctaccctggattccatttctgactcattgagcattgct
ttccgtggtgttagtcactgccctccaagtgggctctatgctcacctctgccgcttcttg
gccctgtgtctgggccaccgagatccttatgccactgcgttccttgttgctgagtctatc
tccatcacctgccgtcaccagctgctcacccacttgcaccgacagctcagcaaggcccag
aagcagcaagaatcacctgaactggcagagcatctgcagaggctggacctgaaggagagg
cccggaggtgtcccactggcccgtatccagcgcctcttttcctttaaggctttgggatct
ggctgcttcccccaggcagagaaggagagtttccaggagcgcctggctctgatccctagt
ggggtgactgtctgtgtgttggctctggccaccctccagcctggaaccttgagcaacact
cttttactgacccgcctggaaaaggacaaccccccaattactgtgaagatccccactgcc
caaaataagctccctctaagcgcagtgctgaaagagtttgatgccatccagaaggaccaa
aaagaaaacagcagctgtactgagaaacgagtatggtggacgggccggctggcactggac
caaaggatggaggcactcatcaccgccctggaggaacaggtgctgggctgctggaggggg
ctgctgctgccatgcagtgctgaccccagccttgcccaggaggcctccaaactacaagag
ctgctgcgggaatgtggctgggaatatcctgactccactctcctgaaagtcatccttagt
ggggccagaatcctcaccagccaggatgttcaggccttggcgtgtgggctgtgcccagcc
cagcctgaccgagcccaagtgctcctgagcgaggcagtaggacaggttcagagccaggag
gcccctcgaagtcaacatcttgtattggtgttagacaaggacctgcaaaagctgccttgg
gaaagcacgcccatcctccaagcacagccggtcacccggctgccctccttccgcttcctg
ctcagctacacagtcactaaagaggctggagcctcatcagtgctgagccaaggtgttgat
ccacagaataccttctatgtgctaaaccctcacagtaacctgtcgagcacagaggagaga
tttcgagccagttttagcagtgaaactggctggaaaggagtgattggggaagtgccaagc
ctcgatcaggtgcaggctgccctgacagagcgggatttatatatctacgcagggcacgga
gccggtgcccgcttccttgatgggcaggctgtcctgcggctgagctgccgggcggtggcc
ctgctgttcggctgcagcagtgcagcccttgccgtgcatggaaacctggagggagctggt
atcgtgctcaagtacatcatggctggctgccccttgtttctaggtaatctctgggatgtg
actgaccgtgacattgaccgttacacagaggctttgctgcagggctggctgggagcaggc
ccaggggctccctttctctactatgccagccaagcccgccaggcccctcgactcaagtac
ctcattggtgctgcacctgtagcctacggcctacctatctctctgcagacaccctga

DBGET integrated database retrieval system