KEGG   Mus musculus (house mouse): 109676
Entry
109676            CDS       T01002                                 
Symbol
Ank2, 100043364, AI835472, AW491075, Ank-2, Gm4392
Name
(RefSeq) ankyrin 2, brain
  KO
K10380  ankyrin
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    109676 (Ank2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    109676 (Ank2)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filament-binding proteins
    109676 (Ank2)
SSDB
Motif
Pfam: UPA_2 ZU5 Death
Other DBs
NCBI-GeneID: 109676
NCBI-ProteinID: NP_848770
MGI: 88025
Ensembl: ENSMUSG00000032826
Vega: OTTMUSG00000043348
UniProt: Q8C8R3
LinkDB
Position
3:complement(126715256..127293996)
AA seq 1050 aa
MTEVLDVSDEEGDDTVTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDS
LRSFSSDRSHTLSHASYLRDSAMIDDTVVIPSHQVSALAKEAERNSYRLSWGTENLDNVA
LSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMP
PMVEGEGLASRLIEVGPSGAQFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCD
YTEDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVL
SSTVVSQVQAVFPEGALTKRIRVGLQAQPMHSELVKKILGNKATFSPIVTLEPRRRKFHK
PITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSF
TTNVSARFWLIDCRQIQESVAFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTD
DKVDKTLEQQENFSEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRL
PLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYAKESESDQEPEEEIGM
TSEKNPQDEQERMEERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHAL
LKYWLERDGKHATDTILIECLTKINRMDIVHLLETNTEPLQERMGRSYAEIEQTITLDHS
EGFSVLPDELCAAKEKKEQEASKESESSDHPPMVSEEDISVGYSTFQDCLPKTEGDSPAA
ALSPQMHQEPVQQDFSGKTQDQQEYYVTTPGAEVEDPQKATAVPDSLCKTPEDISTPPEG
TKPCLQTPVTSERGSPIVQEPEEASEPKEESSPRKTSLVIVESTDDQSQVFERLDGDAAF
QKGDDMPDIPPETVTEEEYVDENGHTVVKKVTRKIIRRYVSSDGTEKEEVTMQGMPQEPV
NIEDGDNYSKVIKRVVLKSDTQQSEVTLSEPSVLSSTSQFQAEPVEGRRVSKVVKTTMVH
GERMEKSLGDSSLATDLPSAKDDFEEDNNE
NT seq 3153 nt   +upstreamnt  +downstreamnt
atgacggaggtccttgatgtttctgatgaagagggtgatgacactgtgacaggtgatggg
ggagaatacctcaggccagaagatctcaaggagctcggagatgactcactgcccagcagt
cagttcctggatggcatgaactaccttcggtacagtctggagggaggaagatccgacagc
ctccggtccttcagttccgacaggtctcacactctgagccatgcatcgtacctgagggac
agtgccatgattgacgacacggttgtgatccccagccaccaggtgtctgcgctagccaag
gaggcagaaaggaattcttatcgtctgagctggggcactgagaacttagacaacgtggct
ctttcttccagtcctattcattcaggtttcctagtcagttttatggtggatgcccgtggt
ggtgccatgcgaggatgcagacacaatggactcagaatcattatcccacctcggaaatgc
acagccccaactcgcgtcacctgccgccttgtgaaacgccatcgactggcaacaatgccg
cccatggtggaaggagaaggcctggccagccgcctgattgaagtcggaccttcgggagct
cagtttcttgggcccgtgatcgtggagatccctcacttcgccgctcttcgaggaaaggag
agggagctggtggtcctgcgcagtgaaaatggggacagctggaaagagcatttctgcgac
tacactgaggatgaattgaacgaaatccttaatggcatggatgaagtgctggacagtcca
gaagacctggaaaagaaacgaatctgccgcatcatcactcgtgacttcccacagtacttt
gcggtggtgtctcgcatcaaacaggacagcaacctgattggccccgagggtggagtactg
agcagcacagtggtgtcacaggtgcaagccgtcttcccagagggcgcactcaccaagcgc
attcgagtaggcctacaggctcaacctatgcatagtgaattggtaaagaagatcttaggc
aacaaagccaccttcagcccaatagtcactttggaacccaggagaagaaaattccacaag
ccaattactatgactattcctgtccccaaagcttcaagtgatgtcatgctgaatggtttt
gggggagacgcaccaaccttaagattactgtgcagcataacaggtggaactacgcctgcc
cagtgggaagacatcacaggaacaacgccactaacatttgtcaatgagtgtgtttccttt
acaaccaacgtgtctgccaggttctggctgatagactgtcgacagattcaggagtctgtt
gcctttgcatcacaagtgtatagagaaattatctgtgtgccatatatggccaaatttgta
gtgtttgccaagtcacatgaccccattgaagccaggttgcggtgtttctgtatgacagat
gacaaagtagataagacccttgaacaacaagaaaacttctctgaggtggccaggagcagg
gatgtggaggtattggaaggaaaacctatttatgttgattgttttggcaacctggttcca
ctaaccaagagtggccaacatcatatattcagcttttttgccttcaaagaaaatagactt
cctctctttgtcaaggttcgtgacacaacccaggaaccttgcgggcgactctcatttatg
aaggaacccaaatccacaagaggactggtgcatcaagctatttgcaacttaaacatcacc
ctgccaatttatgccaaggaatcggagtcagatcaagagccggaggaagagatcggtatg
acatccgaaaaaaatccccaagatgagcaggagcggatggaagaaaggctggcttacatc
gctgatcaccttggcttcagctggacagaattagcaagagaactggatttcactgaggag
caaattcaccaaattcgaatcgagaaccccaactcccttcaagatcagagccacgcactg
ctcaagtactggctggagagggatgggaagcatgccacagataccatcctcatcgaatgc
ctcaccaagatcaacaggatggacattgtacatctcctggagaccaacacagagcccctc
caggagcgcatgggccgcagctatgcagaaatagagcagaccattacgctggaccacagt
gaaggattttcagtccttccagacgagctctgtgctgccaaggagaagaaggagcaggaa
gcttccaaagaaagcgagtctagcgaccacccgcccatggtctccgaagaagacatatct
gtcggttattccacatttcaggattgcctccccaaaactgaaggggacagcccagcagca
gcactgtctcctcaaatgcaccaggagccagttcaacaagatttctcagggaaaacgcaa
gaccagcaggaatattatgtaacaacaccaggggcagaagtggaagaccctcagaaggcc
acagccgttcctgactctctctgtaagactcctgaggacatcagtacccctcctgaggga
acaaagccttgtctccagaccccggtgactagcgaacgtggttctccgattgtgcaagaa
cctgaggaggcttccgagcccaaagaggagagttctccaaggaaaactagcctggtcatt
gttgagtcaacagacgaccagtctcaggtctttgaaagactggatggtgatgccgctttt
caaaagggagacgatatgcctgacatacccccagagacggtcacagaggaagaatatgtt
gatgagaatggacacaccgtggtgaagaaggttacccggaaaatcattaggcggtacgtt
tcctctgatggcacagagaaggaggaggttaccatgcagggaatgcctcaggagccagtc
aacattgaggatggggacaattattccaaagtgataaagcgcgtggtattgaagagtgac
acccagcagtcagaggtgactttgtctgaacccagcgttttgtccagtacctcacagttt
caggccgagccagtagaaggccgtagagtcagcaaagttgttaaaacaaccatggtacac
ggagaacggatggagaagagtcttggggactctagcttagccactgaccttccttcagcc
aaagatgactttgaagaggacaacaatgagtaa

KEGG   Mus musculus (house mouse): 11733
Entry
11733             CDS       T01002                                 
Symbol
Ank1, Ank-1, nb, pale
Name
(RefSeq) ankyrin 1, erythroid
  KO
K10380  ankyrin
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    11733 (Ank1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    11733 (Ank1)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filament-binding proteins
    11733 (Ank1)
SSDB
Motif
Pfam: Ank_2 Ank Ank_4 Ank_5 Ank_3 UPA_2 ZU5 Death
Other DBs
NCBI-GeneID: 11733
NCBI-ProteinID: NP_001264210
MGI: 88024
Ensembl: ENSMUSG00000031543
Vega: OTTMUSG00000026381
UniProt: Q02357 E9QNT8
LinkDB
Position
8:23464852..23640517
AA seq 1862 aa
MGFCKADAATSFLRAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVEL
LHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHL
EVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARND
DTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLH
IASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKN
GLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKP
NSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLL
QRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTG
MVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAA
KYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYT
PLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLG
NKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQ
ADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSNGTTPLAIAKRLGYISVTD
VLKVVTDETSVVLVSDKHRMSYPETVDEILDVSEDEGDELVGSKAERRDSRDVGEEKELL
DFVPKLDQVVESPAIPRIPCVTPETVVIRSEDQEQASKEYDEDSLIPSSPATETSDNISP
VASPVHTGFLVSFMVDARGGSMRGSRHNGLRVVIPPRTCAAPTRITCRLVKPQKLNTPPP
LAEEEGLASRIIALGPTGAQFLSPVIVEIPHFASHGRGDRELVVLRSENGSVWKEHKSRY
GESYLDQILNGMDEELGSLEELEKKRVCRIITTDFPLYFVIMSRLCQDYDTIGPEGGSLR
SKLVPLVQATFPENAVTKKVKLALQAQPVPDELVTKLLGNQATFSPIVTVEPRRRKFHRP
IGLRIPLPPSWTDNPRDSGEGDTTSLRLLCSVIGGTDQAQWEDITGTTKLIYANECANFT
TNVSARFWLSDCPRTAEAVHFATLLYKELTAVPYMAKFVIFAKMNDAREGRLRCYCMTDD
KVDKTLEQHENFVEVARSRDIEVLEGMPLFAELSGNLVPVKKAAQQRSFHFQSFRENRLA
IPVKVRDSSREPGGFLSFLRKTMKYEDTQHILCHLNITMPPCTKGSGAEDRRRTLTPLTL
RYSILSESRLGFTSDTDRVEMRMAVIREHLGLSWAELARELQFSVEDINRIRVENPNSLL
DQSTALLTLWVDREGENAKMENLYTALRNIDRSEIVNMLEGSGRQSRNLKPERRHGDREY
SLSPSQVNGYSSLQDELLSPASLQYALPSPLCADQYWNEVAVIDAIPLAATEHDTMLEMS
DMQVWSAGLTPSLVTAEDSSLECSKAEDSDAIPEWKLEGAHSEDTQGPELGSQDLVEDDT
VDSDATNGLADLLGQEEGQRSEKKRQEVSGTEQDTETEVSLVSGQQRVHARITDSPSVRQ
VLDRSQARTLDWDKQGSTAVHPQEATQSSWQEEVTQGPHSFQRRITTIQGPEPGALQEYE
QVLVSTREHVQRGPPETGSPKAGKEPSLWAPESAFSQEVQGDELQNIPGEQVTEEQFTDE
QGNIVTKKIIRKVVRQVDSSGAIDTQQHEEVELRGSGLQPDLIEGRKGAQIVKRASLKRG
KQ
NT seq 5589 nt   +upstreamnt  +downstreamnt
atgggcttctgtaaagccgatgctgctaccagctttctgcgggcggcacgctcggggaac
ctggacaaggctctggatcacctgcgcaatggagtggacattaacacctgtaaccagaac
gggttgaacggcctgcatctggcctccaaagaaggccatgtgaagatggtggttgaactt
ctgcacaaagagatcattctagaaacgacaaccaagaaggggaacactgctctgcacatc
gctgcccttgctggtcaggatgaggtggtccgggagctggtcaactatggagccaatgtc
aatgcccagtctcagaaaggctttactcccctgtacatggctgctcaggagaaccacttg
gaagtggtgaaatttctactggagaatggagccaatcagaatgtagccacagaagatggc
ttcaccccactggccgtggctctacagcagggtcacgagaatgtggtggctcacctcatc
aactatgggacgaaagggaaagtgcgcctccctgccctgcacatcgcggcccgcaacgat
gacacacggacagccgcagtccttctgcagaatgaccccaacccagatgtgctttccaag
acgggattcacacccctccacatcgcagctcactatgagaacctcaacgtggcccagttg
ctcctcaacaggggagccagcgtcaacttcacacctcagaatggcatcaccccactacac
atcgcctcccgcagggggaacgtgatcatggtgagactcctgctggaccgaggggctcag
atagaaacgaggaccaaggatgaattgacaccgctccactgtgcagctcggaatggacac
gtgagaatctcagagatcctgctggaccacggggcacccatccaagccaaaaccaagaat
ggcttgtccccaatccacatggccgctcagggagaccacctcgactgtgtccgacttcta
ttgcaatacaatgcagagatagacgacatcaccttggatcacctgactcctctccatgtg
gcagcccactgtggccaccaccgggtggctaaggttcttttggataaaggggccaagccc
aactccagagccctgaatggttttaccccgttacacatcgcctgcaagaagaaccacatc
cgtgtaatggagttgctgctgaagacaggagcctccatcgacgcggtcactgagtctggc
ctgacacctctccacgtagcctccttcatgggacaccttcctattgtgaagaacttactg
cagcggggagcgtcacccaatgtctccaatgtgaaagtagaaacccccttgcacatggca
gcccgagcagggcatacagaagtggccaaatatttgctccagaacaaagccaaagccaac
gccaaggccaaggatgaccagacaccgcttcactgtgctgctcgaatcggccacacaggc
atggtgaagctcctgctggagaatggtgccagccccaatctggctaccactgctggccac
acacccctacacaccgcagcccgtgagggacacgtggacacagccctggccctgctggag
aaggaggcatcccaagcctgcatgaccaagaaaggatttacccctctgcacgtggctgct
aagtacgggaaggtacggttggcggagctgctgctggaacacgatgcacaccccaatgca
gctgggaagaacggcttgactcctctgcatgtggccgtccatcacaacaacctggacatt
gtcaaacttcttcttccccgaggtggctccccccacagccctgcctggaatggctacact
cctttgcacatcgctgccaagcagaaccagatagaggtggcccgcagtctactgcagtac
ggagggtcagcgaatgcagagtcggtacaaggcgtgaccccacttcacctggctgcccaa
gagggccacacagaaatggttgctcttctcctgtccaagcaagccaacggcaacctgggg
aacaagagtggactcactcccctccacctggtgtcacaagaaggccatgttccagtggca
gacgtgctgatcaaacatggcgtcaccgtggatgctaccacccggatgggttacaccccg
ctccatgtggccagtcattatggaaacatcaagctggtgaagttcttgctacagcaccag
gcagatgtcaatgccaagaccaagctaggatacagccccttgcaccaggcagctcaacaa
ggacacacagacattgtgacattgctcctgaagaatggtgcttctccaaatgaggtcagc
tcgaacggaaccacacctctggcaatagccaaacgtttgggctacatctctgtaacagac
gtgctcaaggtggtcacagatgaaaccagtgtggtgttagtcagtgacaaacaccggatg
agctaccctgagacggtggacgagatcctggacgtgtctgaagatgaaggtgacgaactt
gtcggctcgaaggctgaaaggcgggactcccgggatgtgggtgaggagaaagagctgttg
gattttgtgccgaagctagaccaagtggtggagtctccagccatcccaaggatcccttgt
gtcacacctgagaccgttgtgatccgatctgaagatcaggaacaagcatctaaagaatat
gatgaggattccctcattcccagcagcccggccacagagacctcagacaacattagccct
gtggctagcccggtccacacagggttcctggtgagcttcatggtggatgcccgaggggga
tccatgagaggaagccgtcataatggcctcagggtggtgatccctccccggacatgcgca
gcacccactcgcatcacctgccgcctcgttaagccgcagaagctgaacacgccaccccca
ctggctgaggaagagggcctagccagcaggatcattgccctgggacccacgggggcccag
ttccttagccctgtgatcgtggaaatcccccattttgcctcccatggccgtggggaccgt
gagctggtggttctgaggagtgaaaacggctctgtgtggaaggagcacaagagtcgttat
ggggaaagctacctggaccagatccttaatggcatggatgaagagctggggagcctggag
gagctggagaagaaacgtgtgtgccgcatcatcaccaccgacttccctctgtactttgtc
atcatgtcccggctctgccaggactacgacaccatcggtcctgaagggggttccctgaga
agcaagctggtaccgctggtacaggcaacgttccctgaaaacgctgtgaccaagaaagtg
aagctggctctgcaggcccagcctgtcccggatgagctggtgaccaagctcctgggtaac
caggccacattcagccccattgtgaccgtggagccgaggcgtcggaagttccaccgtccc
atcgggctgcgaatcccgctccctccctcatggacggacaaccccagggacagtggggag
ggagacaccaccagcctgcgcctactgtgtagcgtcatcggtggaactgaccaagcccag
tgggaagatataacgggaacaaccaaacttatatacgccaatgagtgtgccaactttacc
accaatgtctcagccaggttctggctgtcagactgtccccggactgcggaggctgtgcac
tttgccactctcctgtacaaagagctcacagcagtcccctacatggctaagtttgtcatt
tttgccaagatgaacgacgctcgggaaggacggctccgttgctactgcatgacggatgac
aaagtggacaagaccctggagcagcatgaaaacttcgtggaggtggcccggagcagggac
atagaggttctggaagggatgcctctgtttgcagaactctctgggaacttggttcctgtc
aagaaagcggcccaacagcggagcttccatttccagtcgtttcgagagaatcgtctggcc
atccccgtgaaggtgagggacagcagccgcgagccaggagggttcttgtcgttcctacga
aagacaatgaagtacgaggacacacagcacatcctctgtcacctgaatatcaccatgccc
ccctgcaccaagggcagtggagcagaagacaggagaaggaccctgacacccctgaccctt
cgatacagcattctcagcgagtcgcggctgggttttaccagtgacacagaccgtgtcgaa
atgaggatggctgtcatcagagaacacctcggcctaagctgggcagagctggcccgggag
ctgcagttcagcgtggaagacatcaaccggatccgtgtagaaaaccctaactccttgttg
gaccagagtacagccttgctgaccctctgggtggaccgtgaaggcgaaaatgcaaagatg
gagaatttgtacacagccctgcggaacatcgacaggagtgagattgttaacatgttggag
ggctccggcaggcagagcagaaacctcaaaccagagcggagacatggggaccgggagtac
tcattgtcaccctcccaggtgaatggttactcctcgctgcaggacgagctgctgtccccc
gcctccctgcagtacgctctcccctctccactgtgtgcagaccagtactggaacgaagtg
gccgtcatagacgccatccccctggcggctacagagcatgacaccatgctggagatgtct
gacatgcaggtgtggtctgcgggcctcacaccctccctggtcactgctgaggactcctct
ctggagtgcagcaaggctgaggactctgacgccataccagagtggaagttggaaggggca
cactcagaggacacgcagggcccggagctgggctctcaggacctggtggaggacgacaca
gtggattcagatgccacaaatggcctggcagatttgctaggtcaggaggaaggtcagagg
tcagaaaagaagaggcaggaagtctcaggcacagagcaggacacggagactgaagtgtct
cttgtttcaggccagcagcgagttcacgcccgaatcacagactcaccctcagtgaggcag
gtgctggacagaagccaggccagaacactggactgggataaacagggttccacagcggta
cacccgcaagaagccacacagagctcctggcaagaggaggtcacgcagggcccacactca
ttccagagaaggatcaccaccatccaagggccggagcctggtgcgcttcaggaatacgag
caggtgctggtgtctaccagggagcatgtgcagagggggccacctgagaccggcagcccc
aaagctggcaaggaacctagcctgtgggcacctgagagcgccttctctcaagaggtgcag
ggggatgagcttcagaatattccaggagagcaggtgacggaggaacaattcacagatgaa
cagggcaacattgttaccaagaagatcattcgcaaagtcgtccggcaggtagactcgtct
ggtgccatcgacacccagcagcacgaggaggtggagctaagagggagtggactccagccg
gacctgatagagggcaggaagggggctcagatagtgaagcgggccagcctgaaaaggggc
aagcagtga

KEGG   Mus musculus (house mouse): 11735
Entry
11735             CDS       T01002                                 
Symbol
Ank3, 2900054D09Rik, AI314020, Ank-3, AnkG, Ankyrin-3, Ankyrin-G
Name
(RefSeq) ankyrin 3, epithelial
  KO
K10380  ankyrin
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    11735 (Ank3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    11735 (Ank3)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filament-binding proteins
    11735 (Ank3)
SSDB
Motif
Pfam: Ank_2 Ank Ank_4 Ank_5 Ank_3 UPA_2 ZU5 Death RbsD_FucU
Other DBs
NCBI-GeneID: 11735
NCBI-ProteinID: NP_666117
MGI: 88026
Ensembl: ENSMUSG00000069601
Vega: OTTMUSG00000043361
UniProt: G5E8K5
LinkDB
Position
10:69234608..69863266
AA seq 1961 aa
MSEEPKEKPAKPAHRKRKGKKSDANASYLRAARAGHLEKALDYIKNGVDVNICNQNGLNA
LHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQS
QNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDT
KGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNR
AAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVV
EMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHC
GHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPI
HVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAK
DDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGAS
LSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLL
LDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHV
DMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVG
CHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGN
TALAIARRLGYISVVDTLKVVTEEIMTTTTITEKHKMNVPETMNEVLDMSDDEVRKASAP
EKLSDGEYISDGEEGDKCTWFKIPKVQEVLVKSEDAITGDTDKYLGPQDLKELGDDSLPA
EGYVGFSLGARSASLRSFSSDRSYTLNRSSYARDSMMIEELLVPSKEQHLTFTREFDSDS
LRHYSWAADTLDNVNLVSSPVHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTR
ITCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIV
LRSENGETWKEHQFDSKNEDLAELLNGMDEELDSPEELGTKRICRIITKDFPQYFAVVSR
IKQESNQIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPEETVKKILGNKATF
SPIVTVEPRRRKFHKPITMTIPVPPPSGEGVSNGYKGDATPNLRLLCSITGGTSPAQWED
ITGTTPLTFIKDCVSFTTNVSARFWLADCHQVLETVGLASQLYRELICVPYMAKFVVFAK
TNDPVESSLRCFCMTDDRVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKG
GQQLVFNFYSFKENRLPFSIKIRDTSQEPCGRLSFLKEPKTTKGLPQTAVCNLNITLPAH
KKAEKADRRQSFASLALRKRYSYLTEPSMSPQSPCERTDIRMAIVADHLGLSWTELAREL
NFSVDEINQIRVENPNSLISQSFMLLKKWVTRDGKNATTDALTSVLTKINRIDIVTLLEG
PIFDYGNISGTRSFADENNVFHDPVDGHPSFQVELETPMGLYCTPPNPFQQDDHFSDISS
IESPFRTPSRLSDGLVPSQGNIEHPTGGPPVVTAEDTSLEDSKMDDSVTVTDPADPLDVD
ESQLKDLCQSECAQCWASVPGIPNDGRQAEPLRPQTRKVGMSSEQQEKGKSGPDEEVTED
KVKSLFEDIQLEEVEAEEMTEDQGQAMLNRVQRAELAMSSLAGWQNETPSGSLESPAQAR
RLTGGLLDRLDDSSDQARDSITSYLTGEPGKIEANGNHTAEVIPEAKAKPYFPESQNDIG
KQSIKENLKPKTHGCGRTEEPVSPLTAYQKSLEETSKLVIEDAPKPCVPVGMKKMTRTTA
DGKARLNLQEEEGSTRSEPKQGEGYKVKTKKEIRNVEKKTH
NT seq 5886 nt   +upstreamnt  +downstreamnt
atgagtgaagagccaaaggagaagcccgccaagcctgctcataggaagaggaaaggaaaa
aagtctgatgccaacgcaagttacttaagagcagctcgggcagggcacctggaaaaggcc
cttgactacatcaaaaatggagtggacgtcaacatctgtaaccagaatggattgaatgca
ctccatcttgcttccaaagaaggccatgtggaagtggtctctgagctgctgcagagggaa
gccaatgttgatgccgccacaaagaaaggaaacacggccttacacatcgcatctttggct
gggcaagcggaagtggtcaaggtcttggttacgaacggagcgaatgtcaacgcacaatct
cagaatggcttcacaccattgtatatggcagcccaggagaaccacctggaagtcgtcagg
tttcttctggacaatggcgccagccaaagcctggccacagaggacggcttcacgccattg
gccgtggctctgcaacaaggtcatgaccaagtcgtgtccctcctgctcgagaacgacacg
aagggaaaagtgcgcctcccagccctccacatcgcagcccggaaagacgacaccaaggca
gcagctctgctcctgcagaatgacacaaacgcggacgtggagtcaaagagtggcttcacc
ccgctccacatagctgcccactatgggaacatcaatgtggccacgttgctgttaaaccga
gcggctgctgtggacttcaccgcacggaatgacatcactcccttacacgttgcctcgaag
cgaggaaatgcaaatatggtgaagctattgctggaccggggtgcgaagatcgatgccaag
accagggacggtctgactccgttgcactgtggggcgagaagtggccatgagcaggtggta
gagatgttgcttgacagatccgcccccatcctttcaaaaaccaagaatggattgtcgcca
ctgcacatggccacacaaggagaccatttaaactgcgtccaactcctcctccagcacaac
gtgcccgtggacgacgtcaccaacgactacctgactgccctccatgtggctgcccactgc
ggccattacaaagttgccaaggttcttttggataagaaagctagccccaatgccaaagcc
ctgaatggcttcacccctctccatatcgcctgcaaaaagaaccgcatccgagtaatggaa
ctccttttgaagcacggtgcatctattcaagccgtaaccgagtcgggccttaccccaatc
catgttgctgccttcatgggacatgtaaatatcgtgtcacagctaatgcatcatggagcc
tccccaaacaccaccaatgtgagaggagagacggcattgcatatggcggctcggtccgga
caagcagaagtggtgcggtatctggtccaagatggggctcaggtagaagcaaaagctaag
gatgaccagactccactccacatctcagcccgacttgggaaagctgacatagtgcaacaa
ctgttacagcaaggagcatcccccaatgcagcaacaacttctgggtacaccccccttcac
cttgcggccagagaggggcatgaggatgtagctgcgttcctcctggatcatggagcatct
ttatccataacaacaaagaagggattcacccctctgcacgtggcagccaaatacggaaag
cttgaagtcgcaagtctcctgctgcagaagagtgcgtctcccgatgccgcagggaagagc
gggctaactccactgcatgtagcagcgcattacgataatcagaaagtggcccttctgctc
ttggaccagggagcctcaccccacgcagccgcaaagaatggctatacaccactgcacatc
gcggccaagaagaaccagatggacatagccacgtccctgctggagtacggtgctgatgca
aacgcggttacccggcaagggattgcgtccgtccatcttgcggcacaggaagggcacgtg
gacatggtgtcgctgctcctgagtagaaacgcgaatgtcaacctgagcaataagagcggt
ctcaccccactccacctggctgctcaagaagaccgagtgaatgtggccgaggtccttgtc
aaccagggggcccatgtggatgctcagacaaagatgggctacaccccgctccatgtgggc
tgtcactatggaaatatcaaaatagtcaattttctgctgcagcattctgcaaaagttaat
gccaagacgaagaatggatacacagcactgcaccaggctgctcagcagggccacacgcat
atcatcaatgtcttgcttcagaacaacgcctcccccaatgaactcactgtgaatgggaac
acagctctggccatcgcccggcgccttggttacatctcggtggttgacacactgaaggtc
gtgacggaggaaattatgaccaccactaccatcacggagaagcacaaaatgaatgtccca
gaaacgatgaatgaagtcctcgatatgtcagacgatgaagtaaggaaagccagcgccccc
gaaaagctcagtgatggggaatatatctcagacggtgaagaaggtgataaatgcacatgg
ttcaaaattcccaaagtacaggaggttttggtgaaaagtgaagatgccatcacaggggac
actgacaagtatctcgggccacaggaccttaaggagctaggtgatgactccctgccagca
gaaggttacgtaggcttcagtcttggagcccgttctgccagcctccgctccttcagttcg
gataggtcctacaccttgaacagaagctcctacgcaagggacagcatgatgatagaggaa
cttctggtaccatccaaagagcagcacctgacgttcacgagggagtttgattctgactcc
ctcagacactacagttgggcagcggacacgttagataatgtgaacctggtctcaagcccg
gtgcattctgggtttctggttagctttatggtggacgcgagagggggctccatgcgagga
agccgccaccacgggatgcggatcatcatccctccgcgaaagtgtacggcccccacccgc
atcacgtgccgcctggtaaagagacataaactggccaacccaccccccatggtggaagga
gagggattagccagtaggctggtagaaatgggtcctgcgggggcacaatttttaggcccc
gtcattgtggaaatccctcattttgggtccatgagggggaaggagagagaacttatcgtc
cttcggagcgagaacggagagacctggaaggaacatcagtttgacagtaaaaacgaagac
ctcgcggagcttctcaatggcatggatgaagaactcgacagcccggaagagttgggtaca
aagcgcatctgcagaattatcacaaaggatttcccccagtattttgccgtggtttcccgg
attaagcaggaaagcaaccagatcggtcctgagggtgggattctgagcagcaccaccgtg
cccctcgtccaggcctccttcccagagggcgccttaaccaagaggatccgtgtgggtctc
caggctcagcccgtgccagaggaaacggtaaaaaaaatccttgggaacaaagcaacattt
agcccaattgtcacggtagagccgaggagaaggaagttccataagccgatcaccatgacc
attccggtgcccccgccctcgggagaaggcgtgtccaatgggtacaagggggatgccacg
cccaacctgcggctcctctgcagcatcacaggaggcacctcaccagctcaatgggaagac
atcacaggaacaacccctctgacgttcataaaggattgtgtgtctttcacaaccaacgtt
tcagccagattctggctggcggactgccatcaggtgttagagaccgtagggctagcctcc
cagctgtacagagagctgatatgcgttccctacatggccaagttcgttgtgtttgccaaa
acaaacgacccggtggagtcctcgctgaggtgcttctgtatgacagacgacagggtggac
aaaaccctggagcagcaggagaacttcgaggaggttgccagaagcaaagacattgaggtt
ctggaaggaaagcccatctacgttgattgctatggaaacctggcccctctgaccaaagga
ggacagcagcttgtttttaacttttattctttcaaagaaaacagactgccattttccatc
aagatcagagacaccagtcaagagccctgtggccgcctgtctttcctgaaggagccaaag
acaacaaagggattaccccaaacagctgtttgcaacttaaatattactctgccggcacat
aaaaaggctgagaaggcagacagacgccagagctttgcctccctagctttacgtaagcgc
tacagctacttgactgaacccagcatgagtccgcagagtccttgtgagcggacggatatc
aggatggcgatagtagccgatcacctgggacttagttggacagagctggcaagggaactg
aatttttcagtggatgaaatcaaccaaatacgtgtggaaaatcccaattctttaatttct
cagagcttcatgttattaaaaaagtgggtgaccagagacggaaagaatgccacaactgat
gccttaacttcggtcttaacgaagattaaccggatagacattgtaactctgctggaagga
ccaatatttgattatgggaatatttcaggcaccagaagctttgcagatgaaaacaatgtt
ttccatgacccagttgatggtcacccttcctttcaagtggagctggagacccccatgggg
ttgtactgcacaccacccaaccctttccagcaagatgaccattttagtgatatctctagc
atagagtctccctttaggacccccagtagactgagtgacgggctggtgccttcccaggga
aacatagagcatccaacaggtggacctccagtggtaaccgcagaggacacttctttagaa
gacagcaaaatggacgattctgtaactgtaacagacccggccgacccactggacgtagat
gagagccagttgaaggacctgtgtcagagcgagtgtgctcagtgctgggcgagtgtgccc
gggatcccaaacgacggtcggcaggcagagccactgagaccgcagactagaaaagtaggc
atgagctctgaacagcaggaaaaaggaaaatctggtcctgatgaggaagtgacagaagac
aaggtcaaatctctgtttgaggacattcaacttgaagaagtagaggctgaggagatgaca
gaagaccaggggcaggctatgcttaaccgtgttcagcgagcagaactggcaatgtcttca
cttgcaggttggcagaacgagacgccaagtggaagcctagagtccccagcgcaagctcga
agactaactggtgggttactggaccgtctggatgacagctctgaccaggctcgggattct
attacctcatacctcacgggagaacctgggaagatcgaagcaaatggaaaccacacagcg
gaagtcattccagaagcaaaggcaaaaccctacttcccggaatcccaaaacgatataggg
aaacagagcatcaaggagaacctgaaaccaaaaacacacggatgtggtcgcactgaggaa
ccagtgtcgcccctcacagcctaccagaaatctctggaagaaaccagcaagcttgtcata
gaagacgcacctaaaccctgtgtgcctgtcggcatgaaaaagatgaccaggactacggct
gacggcaaagccaggctcaacctccaggaagaagaggggtccaccaggtcagagcctaag
cagggagaaggctataaggtgaagacgaagaaggaaatccggaacgtggagaagaaaacc
cactag

DBGET integrated database retrieval system