KEGG   Mus musculus (house mouse): 11628
Entry
11628             CDS       T01002                                 
Symbol
Aicda, Aid, Arp2
Name
(RefSeq) activation-induced cytidine deaminase
  KO
K10989  activation-induced cytidine deaminase [EC:3.5.4.38]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04672  Intestinal immune network for IgA production
mmu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    11628 (Aicda)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    11628 (Aicda)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.38  single-stranded DNA cytosine deaminase
     11628 (Aicda)
SSDB
Motif
Pfam: APOBEC2 NAD1 APOBEC_N NAD2 APOBEC3 SNAD4 APOBEC_C APOBEC4_like APOBEC4 APOBEC1 RbcX
Other DBs
NCBI-GeneID: 11628
NCBI-ProteinID: NP_033775
MGI: 1342279
Ensembl: ENSMUSG00000040627
UniProt: Q9WVE0
LinkDB
Position
6:122530768..122541139
AA seq 198 aa
MDSLLMKQKKFLYHFKNVRWAKGRHETYLCYVVKRRDSATSCSLDFGHLRNKSGCHVELL
FLRYISDWDLDPGRCYRVTWFTSWSPCYDCARHVAEFLRWNPNLSLRIFTARLYFCEDRK
AEPEGLRRLHRAGVQIGIMTFKDYFYCWNTFVENRERTFKAWEGLHENSVRLTRQLRRIL
LPLYEVDDLRDAFRMLGF
NT seq 597 nt   +upstreamnt  +downstreamnt
atggacagccttctgatgaagcaaaagaagtttctttaccatttcaaaaatgtccgctgg
gccaagggacggcatgagacctacctctgctacgtggtgaagaggagagatagtgccacc
tcctgctcactggacttcggccaccttcgcaacaagtctggctgccacgtggaattgttg
ttcctacgctacatctcagactgggacctggacccgggccggtgttaccgcgtcacctgg
ttcacctcctggagcccgtgctatgactgtgcccggcacgtggctgagtttctgagatgg
aaccctaacctcagcctgaggattttcaccgcgcgcctctacttctgtgaagaccgcaag
gctgagcctgaggggctgcggagactgcaccgcgctggggtccagatcgggatcatgacc
ttcaaagactatttttactgctggaatacatttgtagaaaatcgtgaaagaactttcaaa
gcctgggaagggctacatgaaaattctgtccggctaaccagacaacttcggcgcatcctt
ttgcccttgtacgaagtcgatgacttgcgagatgcatttcgtatgttgggattttga

DBGET integrated database retrieval system