KEGG   Mus musculus (mouse): 117586Help
Entry
117586            CDS       T01002                                 

Gene name
A1bg, C44
Definition
(RefSeq) alpha-1-B glycoprotein
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_2 Ig_3
Motif
Other DBs
NCBI-GeneID: 117586
NCBI-ProteinID: NP_001074536
MGI: 2152878
Ensembl: ENSMUSG00000022347
UniProt: Q19LI2
LinkDB All DBs
Position
15; 15 D1
AA seq 512 aa AA seqDB search
MSLLATVLLLWGFTLGPGNTLMLDSGSEPKLWAEPQSLLEPWANLTLVCAVDLPTKVFEL
IQNGWFLSQVRLETQVLSYRFSLGAITSNNSGIYRCRCGVEPPVDIHLPALNKWTMLSNA
VEVTGKEPLPRPLAHADPVDWITPGGLPVYVMCQVAMRGVTYLLRQEGVDGVQKPDVQHK
GTAGFLIYKPGNYSCSYLTHAAGEPSEPSDIVTIKMYASQAPPTLCLMGNYLMIYPQKTY
ETLACKAPRNAAEFQLRQGGKVLKIHGFSPTRDAILYYVNLKELDNPGPFTCRYRMHKYM
HVWSEDSKPVELMWSDETLQAPVLTAEPSSRDLEPGSTVQLRCTAPVSGLRFGLQRQGKP
ELVVVQMLNSSGTEAVFELHNISTIDSGNYSCIYMEQAPPFSGSSSSEPVELRVNGPPPK
PRLEALWKSTVHLGQEAIFRCHGHVPRVSMELVREGFKTPFAVASTRSTSAYLKLLFVGP
QHAGNYSCRYTALPPFTFESGISDPVEVIVEG
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgctggctactgtactgctgctctgggggttcactctgggcccaggaaatact
ctaatgctcgattctggcagtgaacctaaactatgggcagagcctcagtccctgctggaa
ccctgggcaaacctgaccctggtgtgtgcagttgatttgccgactaaggtcttcgagctg
atccagaacgggtggttcctgagtcaagtccgacttgagacacaggtgctgtcataccgc
ttttccctgggggccattacaagtaacaacagtggcatctaccgctgcagatgtggcgtg
gaaccccctgttgacattcacctgccagcactgaacaagtggaccatgctaagcaatgct
gtggaggtgacagggaaagagcccttgcctcggcccttggctcatgctgatccagtcgac
tggatcacacctggtggcctgcctgtatacgtgatgtgccaggttgcaatgcggggtgtg
acctacctgctgaggcaggaaggagtggatggcgtccagaaacctgatgtccagcacaag
ggaacagctggctttttaatctacaagcctggcaactacagctgcagctacctaacccat
gcagcaggtgaaccctctgagcccagtgatattgtgaccatcaagatgtatgcctcacag
gctccacccactctgtgtttgatgggaaactacctaatgatctacccccagaagacatat
gagacccttgcctgcaaagctcctcggaatgcagctgaattccaactcaggcaaggaggg
aaggtgctgaaaattcatgggtttagccccaccagagatgctatcctgtactatgtgaac
ttgaaggaactggataacccaggtcctttcacctgccgctaccggatgcacaaatacatg
cacgtttggtcagaggacagcaagcccgtagagttaatgtggagtgatgagactctacaa
gctccggtacttactgcagagccatcgagtagggaccttgagcctggttcaacggtgcag
cttcgatgtactgcacccgtatccggcctgcgctttggcctgcaacgccagggcaaaccg
gaattagttgtggtgcaaatgctgaattcgtctgggaccgaagcagtctttgagctgcac
aatatctcaacaatagactctggaaactacagctgtatctacatggaacaggcaccgcca
ttctcaggatcttcttccagtgagcccgtggagctgcgggtgaatgggccaccacccaag
ccaaggctggaagctctgtggaaaagcacagtacatctgggtcaggaagccatctttcga
tgccacggccatgtgcctagggtcagcatggagctggtacgtgagggctttaaaacaccc
ttcgcggtggcctccacaagaagcacctcagcttacctgaagctgctcttcgtcggtccc
caacatgcaggcaactacagctgccgctatacggccctgccgcccttcacatttgaatca
gggatcagcgaccctgtggaggttatagtagaaggttag

DBGET integrated database retrieval system