Mus musculus (house mouse): 11848 Help Entry 11848             CDS       T01002                                  Symbol Rhoa, Arha, Arha1, Arha2 Name (RefSeq) ras homolog family member A   KO K04513   Ras homolog gene family, member A Organism mmu  Mus musculus (house mouse) Pathway mmu04014   Ras signaling pathway mmu04015   Rap1 signaling pathway mmu04022   cGMP-PKG signaling pathway mmu04024   cAMP signaling pathway mmu04062   Chemokine signaling pathway mmu04071   Sphingolipid signaling pathway mmu04072   Phospholipase D signaling pathway mmu04144   Endocytosis mmu04150   mTOR signaling pathway mmu04270   Vascular smooth muscle contraction mmu04310   Wnt signaling pathway mmu04350   TGF-beta signaling pathway mmu04360   Axon guidance mmu04510   Focal adhesion mmu04520   Adherens junction mmu04530   Tight junction mmu04611   Platelet activation mmu04621   NOD-like receptor signaling pathway mmu04625   C-type lectin receptor signaling pathway mmu04660   T cell receptor signaling pathway mmu04670   Leukocyte transendothelial migration mmu04722   Neurotrophin signaling pathway mmu04810   Regulation of actin cytoskeleton mmu04921   Oxytocin signaling pathway mmu04928   Parathyroid hormone synthesis, secretion and action mmu04972   Pancreatic secretion mmu05100   Bacterial invasion of epithelial cells mmu05132   Salmonella infection mmu05133   Pertussis mmu05135   Yersinia infection mmu05152   Tuberculosis mmu05163   Human cytomegalovirus infection mmu05200   Pathways in cancer mmu05203   Viral carcinogenesis mmu05205   Proteoglycans in cancer mmu05206   MicroRNAs in cancer mmu05210   Colorectal cancer mmu05417   Lipid and atherosclerosis mmu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mmu00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     11848 (Rhoa)    04015 Rap1 signaling pathway     11848 (Rhoa)    04310 Wnt signaling pathway     11848 (Rhoa)    04350 TGF-beta signaling pathway     11848 (Rhoa)    04072 Phospholipase D signaling pathway     11848 (Rhoa)    04071 Sphingolipid signaling pathway     11848 (Rhoa)    04024 cAMP signaling pathway     11848 (Rhoa)    04022 cGMP-PKG signaling pathway     11848 (Rhoa)    04150 mTOR signaling pathway     11848 (Rhoa)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     11848 (Rhoa)   09144 Cellular community - eukaryotes    04510 Focal adhesion     11848 (Rhoa)    04520 Adherens junction     11848 (Rhoa)    04530 Tight junction     11848 (Rhoa)   09142 Cell motility    04810 Regulation of actin cytoskeleton     11848 (Rhoa)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     11848 (Rhoa)    04621 NOD-like receptor signaling pathway     11848 (Rhoa)    04625 C-type lectin receptor signaling pathway     11848 (Rhoa)    04660 T cell receptor signaling pathway     11848 (Rhoa)    04670 Leukocyte transendothelial migration     11848 (Rhoa)    04062 Chemokine signaling pathway     11848 (Rhoa)   09152 Endocrine system    04921 Oxytocin signaling pathway     11848 (Rhoa)    04928 Parathyroid hormone synthesis, secretion and action     11848 (Rhoa)   09153 Circulatory system    04270 Vascular smooth muscle contraction     11848 (Rhoa)   09154 Digestive system    04972 Pancreatic secretion     11848 (Rhoa)   09156 Nervous system    04722 Neurotrophin signaling pathway     11848 (Rhoa)   09158 Development and regeneration    04360 Axon guidance     11848 (Rhoa)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     11848 (Rhoa)    05206 MicroRNAs in cancer     11848 (Rhoa)    05205 Proteoglycans in cancer     11848 (Rhoa)    05203 Viral carcinogenesis     11848 (Rhoa)   09162 Cancer: specific types    05210 Colorectal cancer     11848 (Rhoa)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     11848 (Rhoa)   09171 Infectious disease: bacterial    05132 Salmonella infection     11848 (Rhoa)    05135 Yersinia infection     11848 (Rhoa)    05133 Pertussis     11848 (Rhoa)    05152 Tuberculosis     11848 (Rhoa)    05100 Bacterial invasion of epithelial cells     11848 (Rhoa)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     11848 (Rhoa)    05418 Fluid shear stress and atherosclerosis     11848 (Rhoa)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mmu04131]     11848 (Rhoa)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmu04147]     11848 (Rhoa)    04031 GTP-binding proteins [BR:mmu04031]     11848 (Rhoa) Membrane trafficking [BR:mmu04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     11848 (Rhoa) Exosome [BR:mmu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    11848 (Rhoa)   Exosomal proteins of other body fluids (saliva and urine)    11848 (Rhoa)   Exosomal proteins of colorectal cancer cells    11848 (Rhoa)   Exosomal proteins of bladder cancer cells    11848 (Rhoa) GTP-binding proteins [BR:mmu04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     11848 (Rhoa) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  11848 NCBI-ProteinID:  NP_001300890 MGI:  1096342 Ensembl:  ENSMUSG00000007815 UniProt:  Q9QUI0 Q4VAE6 Structure PDB LinkDB All DBs Position 9:108183359..108215142 Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLIL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatcaggaagaaactggtgattgttggtgatggagcttgtggtaagacatgc ttgctcatagtcttcagcaaggaccagttcccagaggtctatgtgcccacggtgtttgaa aactatgtggcggatatcgaggtggatgggaagcaggtagagttggctttatgggacaca gctggacaggaagattatgaccgcctgcggcctctctcttatccagacaccgatgttata ttgatgtgtttttccattgacagccctgatagtttagaaaacatcccagaaaaatggact ccagaagtcaagcatttctgtccaaatgtgcccatcatcctggttgggaacaagaaggac cttcggaatgacgagcacacgagacgggagttggccaaaatgaagcaggagccggtaaaa cctgaagaaggcagagatatggcaaacaggattggcgcttttgggtacatggagtgttca gcaaagaccaaagatggagtgagagaggtttttgagatggccacgagagctgctctgcaa gctagacgtgggaagaaaaagtctgggtgcctcatcttgtga

Mus musculus (house mouse): 67653 Help Entry 67653             CDS       T01002                                  Symbol 4930544G11Rik Name (RefSeq) RIKEN cDNA 4930544G11 gene   KO K04513   Ras homolog gene family, member A Organism mmu  Mus musculus (house mouse) Pathway mmu04014   Ras signaling pathway mmu04015   Rap1 signaling pathway mmu04022   cGMP-PKG signaling pathway mmu04024   cAMP signaling pathway mmu04062   Chemokine signaling pathway mmu04071   Sphingolipid signaling pathway mmu04072   Phospholipase D signaling pathway mmu04144   Endocytosis mmu04150   mTOR signaling pathway mmu04270   Vascular smooth muscle contraction mmu04310   Wnt signaling pathway mmu04350   TGF-beta signaling pathway mmu04360   Axon guidance mmu04510   Focal adhesion mmu04520   Adherens junction mmu04530   Tight junction mmu04611   Platelet activation mmu04621   NOD-like receptor signaling pathway mmu04625   C-type lectin receptor signaling pathway mmu04660   T cell receptor signaling pathway mmu04670   Leukocyte transendothelial migration mmu04722   Neurotrophin signaling pathway mmu04810   Regulation of actin cytoskeleton mmu04921   Oxytocin signaling pathway mmu04928   Parathyroid hormone synthesis, secretion and action mmu04972   Pancreatic secretion mmu05100   Bacterial invasion of epithelial cells mmu05132   Salmonella infection mmu05133   Pertussis mmu05135   Yersinia infection mmu05152   Tuberculosis mmu05163   Human cytomegalovirus infection mmu05200   Pathways in cancer mmu05203   Viral carcinogenesis mmu05205   Proteoglycans in cancer mmu05206   MicroRNAs in cancer mmu05210   Colorectal cancer mmu05417   Lipid and atherosclerosis mmu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mmu00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     67653 (4930544G11Rik)    04015 Rap1 signaling pathway     67653 (4930544G11Rik)    04310 Wnt signaling pathway     67653 (4930544G11Rik)    04350 TGF-beta signaling pathway     67653 (4930544G11Rik)    04072 Phospholipase D signaling pathway     67653 (4930544G11Rik)    04071 Sphingolipid signaling pathway     67653 (4930544G11Rik)    04024 cAMP signaling pathway     67653 (4930544G11Rik)    04022 cGMP-PKG signaling pathway     67653 (4930544G11Rik)    04150 mTOR signaling pathway     67653 (4930544G11Rik)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     67653 (4930544G11Rik)   09144 Cellular community - eukaryotes    04510 Focal adhesion     67653 (4930544G11Rik)    04520 Adherens junction     67653 (4930544G11Rik)    04530 Tight junction     67653 (4930544G11Rik)   09142 Cell motility    04810 Regulation of actin cytoskeleton     67653 (4930544G11Rik)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     67653 (4930544G11Rik)    04621 NOD-like receptor signaling pathway     67653 (4930544G11Rik)    04625 C-type lectin receptor signaling pathway     67653 (4930544G11Rik)    04660 T cell receptor signaling pathway     67653 (4930544G11Rik)    04670 Leukocyte transendothelial migration     67653 (4930544G11Rik)    04062 Chemokine signaling pathway     67653 (4930544G11Rik)   09152 Endocrine system    04921 Oxytocin signaling pathway     67653 (4930544G11Rik)    04928 Parathyroid hormone synthesis, secretion and action     67653 (4930544G11Rik)   09153 Circulatory system    04270 Vascular smooth muscle contraction     67653 (4930544G11Rik)   09154 Digestive system    04972 Pancreatic secretion     67653 (4930544G11Rik)   09156 Nervous system    04722 Neurotrophin signaling pathway     67653 (4930544G11Rik)   09158 Development and regeneration    04360 Axon guidance     67653 (4930544G11Rik)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     67653 (4930544G11Rik)    05206 MicroRNAs in cancer     67653 (4930544G11Rik)    05205 Proteoglycans in cancer     67653 (4930544G11Rik)    05203 Viral carcinogenesis     67653 (4930544G11Rik)   09162 Cancer: specific types    05210 Colorectal cancer     67653 (4930544G11Rik)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     67653 (4930544G11Rik)   09171 Infectious disease: bacterial    05132 Salmonella infection     67653 (4930544G11Rik)    05135 Yersinia infection     67653 (4930544G11Rik)    05133 Pertussis     67653 (4930544G11Rik)    05152 Tuberculosis     67653 (4930544G11Rik)    05100 Bacterial invasion of epithelial cells     67653 (4930544G11Rik)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     67653 (4930544G11Rik)    05418 Fluid shear stress and atherosclerosis     67653 (4930544G11Rik)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mmu04131]     67653 (4930544G11Rik)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmu04147]     67653 (4930544G11Rik)    04031 GTP-binding proteins [BR:mmu04031]     67653 (4930544G11Rik) Membrane trafficking [BR:mmu04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     67653 (4930544G11Rik) Exosome [BR:mmu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    67653 (4930544G11Rik)   Exosomal proteins of other body fluids (saliva and urine)    67653 (4930544G11Rik)   Exosomal proteins of colorectal cancer cells    67653 (4930544G11Rik)   Exosomal proteins of bladder cancer cells    67653 (4930544G11Rik) GTP-binding proteins [BR:mmu04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     67653 (4930544G11Rik) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU SRPRB Motif Other DBs NCBI-GeneID:  67653 NCBI-ProteinID:  NP_001155245 MGI:  1914903 Ensembl:  ENSMUSG00000036463 UniProt:  Q9CR99 LinkDB All DBs Position 6:65929555..65930998 Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVLLLCFSIGNPDSFGNIPHKWIPEVKHFCPNVPIILVGSKKD LRNDFYTIQELAKRKQAPVRPEQGQGLANSIGAFEYVECSAKTKDGVRRVFEKATRAALQ TNRVKKKTGCFVF NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatccggaagaaactggtgatcgtgggagatggagcttgtggaaaaacatgt ttgctcatcgtcttcagcaaggaccagtttcctgaggtttacgtgcccacagtatttgag aactatgtggctgatatcgaagtggatggaaaacaggtggagttggccctgtgggataca gctggacaagaagattatgatcgcctgaggccactctcctatcccgacactgatgttctc ttgttatgtttctccattggcaaccctgatagctttgggaacatcccacataaatggatt ccagaagtcaagcatttctgtcccaacgtgcccatcatcctggttgggagtaagaaggat cttcggaatgacttctacacgatacaagagttagccaagaggaagcaagcgcctgtgaga cctgaacaaggccaagggttggcgaacagcattggcgctttcgagtatgtggagtgttca gcgaagaccaaagatggagtgaggagggtctttgaaaaggccacaagggctgctctgcaa acgaatcgagtgaagaaaaagactggttgctttgtcttttga

DBGET integrated database retrieval system