KEGG   Mus musculus (house mouse): 11920
Entry
11920             CDS       T01002                                 
Symbol
Atm, AI256621, C030026E19Rik
Name
(RefSeq) ataxia telangiectasia mutated
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu01524  Platinum drug resistance
mmu03440  Homologous recombination
mmu04064  NF-kappa B signaling pathway
mmu04068  FoxO signaling pathway
mmu04110  Cell cycle
mmu04115  p53 signaling pathway
mmu04210  Apoptosis
mmu04218  Cellular senescence
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05202  Transcriptional misregulation in cancer
mmu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    11920 (Atm)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    11920 (Atm)
   04068 FoxO signaling pathway
    11920 (Atm)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    11920 (Atm)
   04210 Apoptosis
    11920 (Atm)
   04115 p53 signaling pathway
    11920 (Atm)
   04218 Cellular senescence
    11920 (Atm)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    11920 (Atm)
   05206 MicroRNAs in cancer
    11920 (Atm)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    11920 (Atm)
   05170 Human immunodeficiency virus 1 infection
    11920 (Atm)
   05165 Human papillomavirus infection
    11920 (Atm)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    11920 (Atm)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    11920 (Atm)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    11920 (Atm)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    11920 (Atm)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     11920 (Atm)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   11920 (Atm)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other termination factors
    11920 (Atm)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    11920 (Atm)
SSDB
Motif
Pfam: PI3_PI4_kinase FAT TAN FATC RYDR_ITPR
Other DBs
NCBI-GeneID: 11920
NCBI-ProteinID: NP_031525
MGI: 107202
Ensembl: ENSMUSG00000034218
UniProt: Q62388 B9EHX4
LinkDB
Position
9:complement(53348422..53448125)
AA seq 3063 aa
MSLALNDLLICCRQLEHDRATERRKEVDKFKRLIQDPETVQHLDRHSDSKQGKYLNWDAV
FRFLQKYIQKEMESLRTAKSNVSATTQSSRQKKMQEISSLVRYFIKCANKRAPRLKCQDL
LNYVMDTVKDSSNGLTYGADCSNILLKDILSVRKYWCEVSQQQWLELFSLYFRLYLKPSQ
DINRVLVARIIHAVTRGCCSQTDGLPSKFLDLFSKAIQYARQEKSSPGLSHILAALNIFL
KSLAVNFRKRVCEAGDEILPTLLYIWTQHRLNDSLKEVIIELIQLQIYIHHPQGARAPEE
GAYESMKWKSILYNLYDLLVNEISHIGSRGKYSSGSRNIAVKENLIDLMADICYQLFDAD
TRSVEISQSYVTQRESTDYSVPCKRRKIDVGWEVIKDYLQKSQSDFDLVPWLQITTRLIS
KYPSSLPNCELSPLILILYQLLPQQRRGERIPYVLRCLKEVALCQGKKSNLESSQKSDLL
KLWIKIWSITFRGISSGQTQTENFGLLEAIIQGSLVELDREFWKLFTGSACKPSSPSVCC
LTLALSICVVPDAIKMGTEQSVCEANRSFSVKESIMRWLLFYQLEDDLEDSTELPPILQS
NFPHLVVEKILVSLTMKNSKAAMKFFQSVPECEQHCEDKEEPSFSEVEELFLQTTFDKMD
FLTTVKEYAVEKFQSSVGFSVQQNLKESLDHYLLGLSEQLLSNYSSEITSSETLVRCSSL
LVGVLGCYCYMGIITEDEAHKSELFQKAKSLMQCAGESISLFKNKTNEESRIGSLRNVMH
LCTSCLCIHTKHTPNKIASGFFLRLLTSKLMNDIADICKSLASCTKKPLDHGVHPGEDDE
DGGGCDSLMEAEGPSSTGLSTAYPASSVSDANDYGENQNAVGAMSPLAADYLSKQDHLLL
DMLRFLGRSVTASQSHTVSFRGADIRRKLLLLLDSSILDLMKPLHLHMYLVLLKDLPGNE
HSLPMEDVVELLQPLSLVCSLHRRDQDVCKTILSNVLHIVTNLGQGSVDMESTRIAQGHF
LTVMGAFWHLTKEKKCVFSVRMALVKCLQTLLEADPYSEWAILNVKGQDFPVNEAFSQFL
ADDHHQVRMLAAGSVNRLFQDMRQGDFSRSLKALPLKFQQTSFNNAYTTAEAGIRGLLCD
SQNPDLLDEIYNRKSVLLMMIAVVLHCSPVCEKQALFALCKSVKENRLEPHLVKKVLEKV
SESFGCRSLEDFMISHLDYLVLEWLNLQDTEYSLSSFPFMLLNYTSIEDFYRSCYKILIP
HLVIRSHFDEVKSIANQIQKCWKSLLVDCFPKILVHILPYFAYEGTRDSYVSQKRETATK
VYDTLKGEDFLGKQIDQVFISNLPEIVVELLMTLHETADSADSDASQSATALCDFSGDLD
PAPNPPYFPSHVIQATFAYISNCHKTKFKSILEILSKIPDSYQKILLAICEQAAETNNVF
KKHRILKIYHLFVSLLLKDIQSGLGGAWAFVLRDVIYTLIHYINKRSSHFTDVSLRSFSL
CCDLLSRVCHTAVTQCKDALESHLHVIVGTLIPLVDYQEVQEQVLDLLKYLVIDNKDNKN
LSVTIKLLDPFPDHVIFKDLRLTQQKIKYSGGPFSLLEEINHFLSVSAYNPLPLTRLEGL
KDLRRQLEQHKDQMLDLLRASQDNPQDGIVVKLVVSLLQLSKMAVNQTGEREVLEAVGRC
LGEIGPLDFSTIAVQHNKDVSYTKAYGLPEDRELQWTLIMLTALNNTLVEDSVKIRSAAA
TCLKNILATKIGHIFWENYKTSADPMLTYLQPFRTSRKKFLEVPRSVKEDVLEGLDAVNL
WVPQSESHDIWIKTLTCAFLDSGGINSEILQLLKPMCEVKTDFCQMLLPYLIHDVLLQDT
HESWRTLLSAHVRGFFTSCFKHSSQASRSATPANSDSESENFLRCCLDKKSQRTMLAVVD
YLRRQKRPSSGTAFDDAFWLDLNYLEVAKVAQSCSAHFTALLYAEIYSDKKSTDEQEKRS
PTFEEGSQGTTISSLSEKSKEETGISLQDLLLEIYRSIGEPDSLYGCGGGKMLQPLTRIR
TYEHEATWEKALVTYDLETSISSSTRQSGIIQALQNLGLSHILSVYLKGLDYERREWCAE
LQELRYQAAWRNMQWGLCASAGQEVEGTSYHESLYNALQCLRNREFSTFYESLRYARVKE
VEELSKGSLESVYSLYPTLSRLQAIGELENSGELFSRSVTDRERSEAYWKWQKHSQLLKD
SDFSFQEPLMALRTVILETLVQKEMERSQGACSKDILTKHLVEFSVLARTFKNTQLPERA
IFKIKQYNSAICGISEWHLEEAQVFWAKKEQSLALSILKQMIKKLDSSFKDKENDAGLKV
IYAECLRVCGSWLAETCLENPAVIMQTYLEKAVKVAGSYDGNSRELRNGQMKAFLSLARF
SDTQYQRIENYMKSSEFENKQTLLKRAKEEVGLLREHKIQTNRYTVKVQRELELDECALR
ALREDRKRFLCKAVENYINCLLSGEEHDLWVFRLCSLWLENSGVSEVNGMMKKDGMKISS
YKFLPLMYQLAARMGTKMTGGLGFHEVLNNLISRISLDHPHHTLFIILALANANKDEFLS
KPETTRRSRITKSTSKENSHLDEDRTEAATRIIHSIRSKRCKMVKDMEALCDAYIILANM
DASQWRAQRKGINIPANQPITKLKNLEDVVVPTMEIKVDPTGEYENLVTIKSFKTEFRLA
GGLNLPKIIDCVGSDGKERRQLVKGRDDLRQDAVMQQVFQMCNTLLQRNTETRKRKLTIC
TYKVVPLSQRSGVLEWCTGTVPIGEYLVNSEDGAHRRYRPNDFSANQCQKKMMEVQKKSF
EEKYDTFMTICQNFEPVFRYFCMEKFLDPAVWFEKRLAYTRSVATSSIVGYILGLGDRHV
QNILINEQSAELVHIDLGVAFEQGKILPTPETVPFRLSRDIVDGMGITGVEGVFRRCCEK
TMEVMRSSQETLLTIVEVLLYDPLFDWTMNPLKALYLQQRPEDESDLHSTPNADDQECKQ
SLSDTDQSFNKVAERVLMRLQEKLKGVEEGTVLSVGGQVNLLIQQAMDPKNLSRLFPGWK
AWV
NT seq 9192 nt   +upstreamnt  +downstreamnt
atgagtctagcactcaatgatctgctcatttgctgccggcagttagagcatgacagagct
acagaaagaaggaaagaagtggataaatttaagcgcctgattcaggatcctgaaacagtt
caacatttagataggcattctgattccaaacaaggaaaatatctgaattgggatgctgtt
ttcaggtttttacagaagtacattcaaaaagaaatggaaagtctgagaacagcaaaatca
aatgtatcagccaccacacagagctccagacagaagaagatgcaagagatcagcagtttg
gtcagatacttcatcaaatgtgcaaacaaaagagcacccaggctaaaatgtcaagacctc
ttgaattatgtcatggatacagtgaaagactcatctaatggtctaacgtatggagctgac
tgtagcaacatactactcaaagacattctttctgtgagaaaatactggtgtgaagtatct
cagcaacagtggctagaattgttttcactgtacttcaggctgtatctcaagccatcacag
gacattaatagagttttagtggctagaataattcatgctgtcaccagaggatgctgttca
cagactgatggattaccttcaaagtttttagatcttttttccaaggctattcagtatgcc
agacaagaaaagagctctcctggcttaagtcacatcttagcagcccttaacattttcctc
aagtctctggctgtcaacttccgaaaacgggtgtgtgaagcaggagatgaaattcttcct
accttactatatatttggactcaacatagacttaatgattctttaaaagaagtaattatt
gaactaattcaactgcagatttatatccatcatccacaaggagccagagctcctgaagaa
ggtgcttatgaatccatgaaatggaaaagtatcttgtacaacttatatgacttgctagtg
aatgagataagtcatataggaagccgagggaaatattcctcaggatctcgtaatattgct
gtcaaggaaaatctgattgacctgatggcagatatctgttaccagctttttgatgcagat
accagatccgtggagatttctcaatcttatgtgacacaaagggaatccactgattacagt
gtaccttgcaaaagaaggaaaatagacgtaggctgggaagtgataaaagattatcttcag
aagtcacagagtgattttgatctcgtgccttggctacagattacaacccgattaatatca
aaatatccttccagtttacctaactgtgagctgtctccattaatactgatactgtaccag
cttctgcctcaacagcgacgtggagaacgcatcccatatgtgttacgatgccttaaggaa
gttgccttatgtcaaggcaagaaatcaaacctggaaagctctcagaagtcagatttattg
aaactatggatcaaaatttggtctattacctttcgtggtataagttctggacaaacacaa
actgaaaactttggtttacttgaggccatcattcaaggtagtttagttgaacttgacaga
gaattctggaagttatttactggctcagcctgtaaaccttctagtccttcagtatgctgc
ttgactttggcacttagcatctgtgtagttccagatgcaataaaaatgggaacagaacaa
agtgtgtgtgaagcaaatagaagtttttctgtaaaggagtcaataatgaggtggctctta
ttctaccagttagaggatgacttagaagacagcacagagctgcctccaattcttcagagt
aattttcctcatcttgtagtcgaaaaaattcttgtaagtctcactatgaaaaactcaaaa
gctgcaatgaagttttttcaaagtgtgccagaatgtgaacaacactgcgaagataaagaa
gagccttcattttcagaagtagaagaactgtttcttcagactacttttgacaagatggat
tttttaactactgtcaaagagtatgctgtagaaaaatttcagtctagtgttggcttctct
gtccagcaaaatctcaaggaatcattggatcactatcttctgggattatcagaacagctt
ttaagtaattactcttctgagattacaagttctgaaacccttgtccggtgttcaagtctt
ttggtgggtgttcttggctgctattgttacatgggtataataactgaagacgaagcccat
aaatcagaattattccagaaagccaagtctctgatgcaatgtgcaggagaaagtatctct
ctgtttaaaaataaaacaaatgaggaatcaagaattggttcattgagaaatgtgatgcat
ctgtgtacaagttgcttgtgtatacataccaagcatacgccaaacaagattgcctctggc
tttttcctacgattattaacatcaaagcttatgaatgacattgcagatatttgtaaaagt
ttagcatcctgtacgaaaaagccattggatcacggagtacatccaggggaagatgatgaa
gatggtggtggttgtgacagtctgatggaggcagagggtccatcgtccactggtctttct
actgcttaccccgctagttctgtgagcgatgcaaatgattatggagagaaccagaatgct
gttggtgccatgagtcctttagctgccgactacctgtccaaacaagatcatcttctctta
gacatgctcaggttcttaggccgatctgtaactgcatctcagagccatactgtgtcgttt
agaggagctgacattagaagaaaattgttactgttgcttgattctagcatactcgatctc
atgaagcccctccacctgcatatgtacttagtgctcctgaaggatctccctggaaacgag
cactcattgccaatggaagatgttgttgaacttctgcaaccattatcccttgtgtgttct
ctgcaccgacgtgaccaagatgtctgtaaaacgattctaagcaatgtccttcatatagtg
acaaacctaggccagggcagtgtggacatggagagcacacggattgctcaaggacacttc
ctgacagtgatgggagcattttggcatttgacaaaggaaaagaaatgtgtattctctgta
agaatggcattagtaaagtgtcttcaaacattgcttgaggctgatccatattccgaatgg
gcaattcttaatgtaaaaggacaagactttcctgtaaatgaagctttttcacaatttctt
gctgacgatcatcatcaagttcggatgttggctgcagggtcagtcaacagattatttcag
gatatgagacaaggcgatttctccagaagcttgaaagcactccctctgaagtttcagcag
acatcttttaacaatgcatacacgacagcagaggcggggatcagaggactgttatgtgat
tctcagaaccctgatctgctggatgagatctataacagaaaatctgtactactgatgatg
atagctgtggtcttgcactgtagcccagtctgtgaaaagcaggctttgtttgctttatgc
aagtctgtgaaggaaaacagactagaacctcatcttgtgaaaaaggttttagagaaagtc
tccgaatcgtttggatgtagaagtttagaagacttcatgatttctcacctagactacctg
gttttggaatggctgaaccttcaagatactgaatatagcttatcttcttttccttttatg
ttattaaactacacaagcattgaggatttctatcggtcttgttacaagattttgatccca
catttggtaatcagaagccattttgatgaggtgaagtccattgctaatcagattcaaaag
tgctggaaaagcctgttggtagattgctttccgaagattcttgtgcacatccttccttac
tttgcctacgagggcacgagagacagctacgtgtcacagaaaagagagactgctaccaag
gtctacgatactcttaaaggggaagacttcctaggaaaacagattgaccaagtattcatt
agtaatttgccagagattgtggtggagttgctgatgacattgcatgagacagctgactcg
gctgactcggacgccagtcaaagcgccaccgccttgtgtgatttttcaggggatttggat
cctgcccccaacccgccatatttcccctcacatgtcattcaggcaacgtttgcttacatc
agcaactgtcataaaaccaagtttaaaagcattctagaaattctttctaaaatccccgat
tcctatcagaaaatacttctggccatttgtgaacaagcagctgagacaaataatgtcttt
aaaaagcacagaattcttaaaatatatcacctgtttgttagtttattactgaaagatata
cagagtggcctgggaggggcttgggcctttgtccttcgcgatgttatttatactctgatt
cactacatcaacaaaaggtcttctcatttcacagatgtgtcgttgcgtagcttttccctt
tgctgtgacctattaagtcgagtttgtcatacagctgtaactcaatgtaaggatgctcta
gaaagccatcttcacgttatcgttggcacacttattccccttgtggattatcaggaagtt
caagaacaggtattggacctgttgaagtacttagtgatagataacaaagacaataaaaac
ctctctgtcacaattaagcttttggatccctttcctgaccatgttatttttaaggacttg
cgtcttactcaacagaaaatcaaatatagtggaggacctttttcactcttagaggaaata
aaccattttctctcagtaagtgcttacaatccacttccgctgaccaggcttgaaggactg
aaggatcttcgaagacaactggagcaacataaagatcagatgctagatcttctgagagcg
tctcaagataacccacaagatggcattgtggtgaagctagttgtcagcttgttgcagtta
tccaagatggcagtgaaccagactggtgaaagagaagttttagaggctgtcggaaggtgt
ttgggagaaataggtcctctggatttctccaccatagctgtccagcataacaaagatgtg
tcctataccaaagcctacgggttacctgaagacagagaacttcagtggaccttgataatg
ctgactgccctcaacaataccctggtagaggacagtgtcaaaattcgatctgctgctgct
acctgtttgaaaaacattttggctacaaagattggacatattttctgggagaattataag
acatcagcggatccaatgctgacctatctacaaccttttagaacatcgaggaaaaagttt
ttagaagtgccccgatctgttaaagaagatgttttagaaggcctggatgctgtgaatctg
tgggttcctcaaagtgaaagtcatgacatttggataaagacactgacgtgtgcctttctg
gacagtggaggcataaacagtgaaattctccagttattaaagccaatgtgtgaagtgaaa
accgacttctgtcagatgttgctgccatacttgatccatgatgttttactgcaagataca
catgaatcgtggagaactctgctgtctgcgcacgtccgaggatttttcactagttgtttt
aagcattcctcccaagcaagccgctcagcaactcctgcaaattcggattcagagtcagag
aactttctccgatgctgtttggataaaaagtcacaaagaaccatgcttgctgttgtcgac
tatctgagaaggcaaaagagaccttcctcgggaacagcttttgatgacgctttctggctg
gatttgaattatcttgaggttgcgaaggtggctcagtcctgctctgctcacttcacggcc
ttgctctacgcagagatctattcagataagaaaagcacagacgagcaagagaaaagaagt
ccaacatttgaagaaggaagtcaaggaacaactatttctagtttgagtgaaaaaagtaaa
gaagaaactggaataagcttacaggatcttctcttagagatctacagaagtataggagag
ccggacagcctgtatggctgtggaggagggaaaatgttacaaccccttactagaatacgg
acatatgaacatgaagctacgtgggagaaagccttagtaacttacgacctggagaccagc
atctcctcctccacccgccagtcaggaatcatccaggccctgcagaatttggggctctcc
catatcctgtctgtctatctgaaaggattagactatgaaagacgagagtggtgcgctgag
ctgcaggagctgcgttaccaggcggcgtggaggaacatgcagtggggcctctgcgcttct
gccggccaagaagtagaaggaaccagttaccatgaatcgttgtataatgctctgcagtgt
ctaagaaacagagaattctccacattttatgaaagtctccgatatgccagggtgaaagaa
gttgaagagttgagtaagggcagccttgagtctgtatattcgctgtatcccacacttagt
agattgcaggcaattggagaactggaaaacagtggcgagcttttctcaaggtcagtcaca
gacagagagcgctctgaagcatactggaagtggcagaagcactcccagcttctgaaagac
agcgacttcagctttcaggagcctctcatggctctgcgcacagtcattctggagaccctg
gtacagaaggaaatggagcgctctcaaggagcatgctctaaggacattctcaccaaacac
ctcgttgaattctctgttctggctcgaaccttcaagaacacacagctccctgaaagagca
atattcaaaattaagcaatataattcagctatttgtggaatttctgagtggcatttggaa
gaagcacaagtattctgggcaaaaaaggagcagagtcttgctctgagtattctcaagcag
atgatcaagaagttggactccagctttaaagataaagagaatgatgcaggtctcaaagtc
atatacgcagagtgtctgagggtttgtggcagctggctggcagaaacttgcttagaaaac
cctgcagtcatcatgcagacctatctagaaaaggcggtgaaggttgctggaagttacgat
ggcaacagcagagagctcagaaatggacagatgaaggcctttctctcgttggcaaggttc
tctgatactcagtaccagagaattgaaaactacatgaagtcatcagaatttgaaaacaag
caaactctcttaaaaagagccaaagaggaagtgggccttctaagggaacataaaattcag
accaacagatacacagtaaaggttcagcgagaactggagctggacgaatgtgctctccgt
gcactgagagaggatcgcaagcgcttcctgtgtaaagcagtggagaactacatcaactgc
ttactaagcggggaagaacatgatctgtgggtgttccggctttgctccctctggcttgaa
aattctggagtttctgaagtcaatggcatgatgaagaaagatggaatgaagatttcatcc
tataagtttttgcctctcatgtatcaattggctgctcgaatggggaccaaaatgacggga
ggcctaggatttcacgaagtcctcaataatctaatctctaggatttcactggatcacccc
catcatactttgttcattatactggccttagcaaatgcgaacaaagatgaatttttgagc
aaaccagagacaacaagaaggagtcgaataaccaaaagtacatctaaagaaaactctcac
cttgatgaggatcgaacagaggctgcaaccagaatcatccactccatcagaagtaagcga
tgtaagatggtgaaggacatggaggcgctctgcgatgcctacatcatcttggcaaacatg
gacgcctctcagtggagggctcagagaaaaggcatcaatattccagccaaccagccaatc
actaaactgaagaatttagaagatgttgttgttcccactatggaaattaaggttgatccc
acaggagagtatgaaaatctggtgactataaaatcatttaaaacagaatttcgcttagct
ggaggcttaaatttacccaaaataatagattgtgtgggttctgatggcaaggaaaggaga
cagcttgtgaagggccgtgatgacctgaggcaagatgctgtcatgcagcaggtcttccag
atgtgcaatacactactgcagagaaacactgagactagaaagaggaaactgactatctgc
acatacaaggtggttcccctttctcagcgaagcggtgttctcgagtggtgcacaggaacc
gttcctattggtgaatatcttgttaacagcgaagacggtgcacatagaagatacaggcca
aatgatttcagtgccaatcagtgccaaaagaaaatgatggaagtgcagaagaagtctttt
gaagagaaatatgataccttcatgacgatttgccaaaactttgaaccagttttccgttac
ttctgcatggaaaaattcttggacccagctgtttggtttgagaaacgattggcatataca
cgcagtgtggccacatcttctatcgtcggttacatccttggacttggcgacaggcacgta
cagaatatcttgataaacgagcagtcggcagagcttgtgcacatagacctgggagtggct
tttgaacaggggaagatccttcccactccagaaacagttccttttagactcagcagagat
attgtggacgggatgggcatcaccggtgtggaaggtgtcttcagaaggtgctgtgaaaaa
acgatggaagttatgcggagttctcaggaaaccctgctgaccattgtagaggttcttttg
tacgatccactctttgattggactatgaatcctttaaaagctctgtatctacagcagaga
ccagaagatgagtccgacctccattccacccccaatgcagatgatcaagaatgcaaacaa
agtcttagtgatactgaccagagtttcaacaaagtagctgagcgtgtcttgatgagactg
caagagaaactgaaaggcgtggaggaaggcactgtgctcagtgtgggtggacaggtgaac
ttgcttatccagcaggccatggatcccaaaaatctcagccgactcttcccaggatggaaa
gcttgggtgtga

KEGG   Mus musculus (house mouse): 245000
Entry
245000            CDS       T01002                                 
Symbol
Atr
Name
(RefSeq) ataxia telangiectasia and Rad3 related
  KO
K06640  serine/threonine-protein kinase ATR [EC:2.7.11.1]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03460  Fanconi anemia pathway
mmu04110  Cell cycle
mmu04115  p53 signaling pathway
mmu04218  Cellular senescence
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    245000 (Atr)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    245000 (Atr)
   04115 p53 signaling pathway
    245000 (Atr)
   04218 Cellular senescence
    245000 (Atr)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    245000 (Atr)
   05170 Human immunodeficiency virus 1 infection
    245000 (Atr)
   05165 Human papillomavirus infection
    245000 (Atr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    245000 (Atr)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    245000 (Atr)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     245000 (Atr)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   245000 (Atr)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    245000 (Atr)
SSDB
Motif
Pfam: PI3_PI4_kinase FAT UME FATC IFRD Mad3_BUB1_I THP2
Other DBs
NCBI-GeneID: 245000
NCBI-ProteinID: NP_063917
MGI: 108028
Ensembl: ENSMUSG00000032409
UniProt: A0A1L1SSL9
LinkDB
Position
9:95739650..95834813
AA seq 2641 aa
MGDHGLELASMIPALRELASATPEEYNTVVQKPRQILCQFIDRILTDVNVVALELVKKTD
AQPTSVMLLDFIQHIMKSSPLMFVNVNGSQGQNEAKDSCIEFSHWIITRLLRIAATPSCH
MLHKKICEVICSLLFLFKSKNPAIFGVLTRELLYLFEDLIYLHKRNAVGEVMEWPVVVSR
FLSRLDEHMGCLQPAPLQFMNVQNVEFIEVTLLMVLIHIVPTVFFRRQELLLWQIGCALL
EHGSPKIRSLAISLLTELFELGGLPAQPASTFFSLFLELLQHLVGMDADQLKLYEEPLSK
LLKTLFPFEAEAYRNIEPVYLNVLLEKLSVMFEDRVLMRLKSDLLKAALCHLLQYFLTFV
PAGYESALQVRKVYVTNICRALVDALGVQKHVGYLLGPFYAALKMESKEIIERIQCQAQQ
ENLSGNNDEVSPKRRKLSSSLSSYKKPSRQPEEIIHVDMDKKSILWNVLKQKAESLQISL
ECGTLKNSVAEALEGITVVLQLTALCTVHCSHQDMDGHNVKDHQHKYKKKPPVVVTWMSL
DFYTKVLKSCRSLLESVQKLELELVIDSMVRICDALMYMQVKSSFKDHVLEELCGMLSLP
WIYSYSDDNSLKMTTFATNLLPLSQRVWDSYSPQAQSKCVFLLTLFPRRIFLEWRTAVYN
WALKSSHEVIRASCVKGFFILLHQQNSCNQIPKMLVDRVKDDSDMVKKEFASVLGQLVCT
LHGMFYLSSSVEPCFEHMDLFSKNLKATSQHECSSSQVKASTCKPFLFLLTKNTPSPVKL
AFIDNLHHLCKHLDFQEDEREVKAVLGTLLNLMEDPDKDVRIAFSGNIKYILESLNSEDG
FVKELFVLRMKEAYTHAQIARNNELKDTLILTTGDIGRAAKGDLIPFALLHLLHCLLSKS
ASVSGAAYTEIRALVAAKSVKLQNFFSQYKKPICQFLVESLHSSQMTALPSAPCQSSEIR
KQDVAHHREMALNTLSEIANVFDFPDLNRFLTRTLQVLLPDLAAKASPAASALIRTLGKQ
LNVSRREILINNFKYIFSHLVCSCSKDELERALHYLKNETEIELGSLLRQDFQGLHNELL
LRIGEHYQQVFNGLSILASFASSDDPYQGPRDITSPELMADYLQPKLLGILAFFNMQLLS
SSVGIEDKKMALTSLMSLMKLMGPKHVSSVRVKMMTTLRTGLRFKDDFPELCCRAWDCFV
RCLDHAYLGPLLSHVIVALLPLIHMQPKETAAIFHYLIIENRDAVQDFLHEIYFLPDHPE
LEKIKAVLQEYRKETSETTDLQTTLQLSMKAIQHENVDVRIHALTSLKETLYKNQEKLIK
YATDSETVEPVISQLVTVILKGCQDANSQARLLCGECLGELGAIDPGRLDFSTTETQGKD
FTFVTGVEDLSFAYGLLMELTRAYLAYADNSRAQDSAAYAIQELLSIYDCREMQSNGPGY
QLWKRFPEHVREILEPHLNTRYKSSQKSTDWSGVTKPIYLSKLGNNFAEWSSSWAGYLIT
KVRDNLASKIFTCCSIMMKHDFKVTIYLLPHILVYVLLGCNQEDQQEVYAEIMAVLKHDE
QHAISTQDSASDLCQLSTQTVFSVLDHLTQWARHKFQALNAEKLAQNKPKGGKVNKILSN
VNFEDYQSVTRFLDLIPQDTLAVASFRSKAYTRAVMHFESFITEKKQNIQKHLGFLQKLY
AAMHEPDGVAGVSAIRKAEPSLKEQILEHESIGLLRDATACYDRAIQLEPDQIIHYHGVV
KSMLGLGQLSTVITQVNGVHANRSEWTDELNTYRVEAAWKLSQWDLVENYLAADGKSTTW
SVRLGQLLLSAKKRDTTTFYDTLKLVRAEQIVPLSAASFERGSYQRGYEFIVRLHMLCEL
EHSLKPLFRKSPGDSCNEDSLNWGARLEMTQNSYRAKEPILALRRALLSLNKRPDYNEMV
GECWLQSARVARKAGHHQTAYNALLNAGESRLAELYVERAKWLWSKGDVHQALIVLQKGV
ELCFPENKSPSESKHMLIHGRATLLVGRFMEETANFESNAVMKKYKDVTLFLPEWEDGHF
YLAKYYDKLMPMVTDNKMEKQGDLIRYIVLHFGRSLQYGNQFIYQSMPRMLSLWLDFGAK
AYEWEKGGRSDRLQMRNDLAKINSVLTEHTNRLAPYQFLTAFSQLISRICHSHDEVFVVL
MEIIAKVFLAYPQQAMWMMTAVSKSSYPMRVNRCKEILTKAIHMKKSLEKFVGDATRLTD
KLLELCNKSVDGSNSTLSMSTHFKMLKRLVEDPTFSEILIPLQSVMIPTLPSVLGAHANH
DPFPGHWAYLAGFDDVVEILSSLQKPKKISLKGSDGKFYIMMCKPKDDLRKDCRLMEFNS
LINKSLRKDAESRRRELHIRTYAVIPLNDECGIIEWVNNTAGLRPILTKIYKEKGVYMTG
KELRQCMLPKSAALSEKLKVFQELLLPRHPPVFHEWFLRTFPDPTSWYSSRSAYCRSTAV
MSMVGYILGLGDRHGENILFDSFTGECVHVDFNCLFNKGETFEVPEIVPFRLTHNMVNGM
GPMGTEGLFRRACEVTLRLMRDQREPLMSVLKTFLHDPLVEWSKPVKGHSKAPLNETGEV
VNEKAKTHVLDIEQRLQGVIKTRNRVTGLPLSIEGHVHYLIQEATDENLLCQMYLGWTPY
M
NT seq 7926 nt   +upstreamnt  +downstreamnt
atgggcgaccacgggctggagctggcgtccatgatccccgccctgcgggagttggccagt
gctactccagaagaatataacactgttgtacagaaaccaagacagattctctgccagttc
attgacagaatacttacagatgtaaatgttgttgctctagaacttgtaaagaaaactgac
gctcagccgacctctgtgatgttacttgattttatccagcacatcatgaagtcttctccg
cttatgtttgtaaatgtgaatggaagccagggccaaaatgaggccaaagacagttgtatt
gaattcagtcattggatcattacaagacttttacggattgcagcaactccatcctgccac
atgctacacaagaaaatatgtgaagttatctgctcgttattatttctttttaaaagcaag
aatcctgctatttttggggtactcacaagagaattactttatctttttgaagacttaatt
tacctccacaaaagaaatgcagtgggtgaggttatggaatggccagtggttgttagtcgg
tttttaagccgattggatgaacatatgggatgtttacagccagctcctttgcagttcatg
aacgtgcaaaatgtagaatttattgaagtcactctattaatggttcttattcatattgtt
ccaaccgtgttttttagacgacaagaattgttactgtggcaaatcggctgcgctctgcta
gagcacggtagtcccaaaatcaggtctttagcaattagccttctaactgagctctttgag
cttggagggttaccagcacagccagccagcacttttttcagcttatttttggagttgcta
caacaccttgttggaatggatgctgaccaattgaaattgtatgaagagccattgtcaaag
ctgctaaaaacgctctttccctttgaagcagaggcttatagaaatattgaacctgtctac
ttaaatgtgctactggaaaaactcagtgtcatgtttgaagatcgcgtgcttatgcggctc
aagtctgatttgctgaaggctgctttgtgtcatttactgcagtatttccttacatttgtg
ccagctgggtatgaatcggctttacaggtcaggaaggtttatgtgacaaatatttgtaga
gctcttgtagacgctcttggagttcagaaacatgttgggtatttgttgggaccattttat
gcagccttgaaaatggaaagtaaggaaattattgaaagaattcaatgccaagctcaacag
gagaatctcagtggtaataatgatgaggtgtcaccaaagaggcgtaaactcagctcctct
ctcagctcttacaaaaagccatccagacagcctgaagaaattattcatgtggatatggac
aaaaagagcatattatggaatgttctgaaacagaaagccgaatcccttcagatctctctc
gaatgtggtactctcaagaattctgttgctgaggcattagaaggaatcactgttgtatta
cagctgactgctctctgcactgttcactgttctcatcaagacatggatggccataatgtc
aaggatcatcaacacaaatataagaagaaacctccagtagtagtaacttggatgtctttg
gatttttatacaaaagtgcttaaaagctgtaggagtttgttagaatctgttcagaaactt
gaactggaattagtcattgatagcatggtgagaatttgtgatgctctgatgtatatgcaa
gtaaaaagttcattcaaggatcatgttctggaagagttatgtggaatgctctcacttcca
tggatttattcctattctgatgataactctttaaagatgaccacatttgctactaacctt
ctgccattaagccagagggtttgggatagttactctccacaggcacagtcaaaatgtgtg
tttcttctgacactgtttccaagaagaatattccttgaatggagaacagcagtttataat
tgggccctaaagagctcccatgaagtaatccgggctagttgtgttaaaggattttttatc
ttattgcatcagcagaattcttgtaaccaaattcccaagatgcttgtagatagagtcaaa
gatgattctgacatggtcaagaaagaatttgcttctgtccttggtcaacttgtctgtact
cttcacggcatgttttatttgagttcctcagtagagccttgctttgaacatatggacttg
ttcagtaagaacctgaaagccacttctcagcatgaatgttcatcttctcaagtaaaagct
tccacttgcaagccattccttttcctgctgaccaaaaatacacctagtccagtaaaactt
gctttcatagacaatctacatcatctttgtaagcatcttgattttcaagaagatgaaaga
gaggtaaaagcagttcttgggactttattaaatttgatggaagatccagacaaggatgtt
agaattgcttttagtggaaatatcaagtatatattggaatccttgaactctgaagatgga
ttcgtaaaagagctttttgtcttaagaatgaaggaagcatatactcatgcccaaatagca
aggaataatgagctaaaggatactttgattcttacaacaggggatattggaagggcagca
aaaggagatttgatacctttcgcactcttgcatttactgcattgcttgctgtctaagtct
gcatccgtctctggagcggcatacacagagattcgagcactagttgcagctaaaagtgtt
aaactgcagaattttttcagtcaatataagaaaccgatctgtcagtttttggtagaatct
ctccactccagtcagatgacagcactcccaagtgctccttgccagtcttctgagattcga
aaacaagatgttgctcatcacagagagatggctttaaataccttatcagaaattgccaat
gtttttgactttcctgatcttaatcgtttcctgacaaggacattacaagttctgcttcct
gatcttgctgccaaagcaagtcctgcagcatcggctctcattcgaactttagggaaacaa
ttaaatgtcagtcgtcgagagattttaataaataacttcaaatacatcttttcccatttg
gtttgttcttgttccaaagatgaattagaacgtgctcttcattatctgaagaatgaaaca
gaaattgagttggggagcctgttaagacaggattttcaaggattgcataacgaattattg
ctgcgtattggagaacattatcaacaagttttcaatggtttgtcaatacttgcctcattt
gcatctagtgatgatccatatcagggaccacgagatattacatcacctgaactgatggct
gattatttgcaaccaaaattgttgggcattctggccttttttaatatgcagttgctgagc
tccagtgttggcattgaagataagaaaatggccttgactagtttgatgtctttgatgaag
ttgatgggacctaaacatgtcagttctgtgagagtaaaaatgatgaccacactgagaact
ggtcttagattcaaggatgattttcctgagttatgctgcagagcatgggactgctttgtt
cgctgtctggatcacgcttacctgggacccctgctcagtcatgtcatagtggctttgtta
cctctcatacacatgcagcctaaagaaactgctgctatctttcactacctcatcattgaa
aacagggatgctgtgcaagattttcttcatgaaatatattttttgcctgatcatccagaa
ttagaaaagataaaagcagttctccaggaatatagaaaggaaacctctgagactactgat
cttcaaaccactctccagctatctatgaaagcaattcaacacgaaaatgtagatgttcga
attcatgctcttacaagcttgaaggaaaccttgtacaaaaatcaggaaaaactgataaaa
tatgcaactgatagtgagacagtggagcccgttatctcccagcttgtgacggtaattctg
aaaggctgccaagatgcaaactctcaagctcgcttactctgtggggaatgtttaggagaa
ctgggggcaatagacccagggcgattggatttctcaacaacagaaactcaaggaaaagat
tttacatttgtgactggagtagaagatttaagctttgcctatggattgctaatggagcta
acaagagcttaccttgcatatgctgataacagccgagcacaagattcagctgcttatgct
attcaggagttgctttctatttatgactgtagagagatgcagagcaatggcccaggttac
cagttgtggaaaagattccctgagcatgtccgggaaatattagagcctcatctcaatact
agatataagagttcccagaaatcaacagattggtctggagtaacgaagccaatttactta
agtaaactaggtaataactttgcagaatggtcatcatcttgggcaggttatcttataaca
aaggttcgggataatcttgccagtaagatcttcacatgctgtagcataatgatgaagcat
gattttaaagtcaccatctatcttcttccacatatcctagtatatgtcttgttgggttgt
aatcaagaagatcagcaagaggtttatgcagaaattatggcagtacttaagcatgatgag
cagcatgccatcagtacccaagacagtgcatctgatctgtgccagctgagtacacagact
gtgttctctgtgcttgaccatctcacccaatgggcaaggcacaaatttcaggcattgaat
gctgagaaacttgcacaaaacaaaccaaaaggaggtaaggtcaacaaaatattatcaaat
gtgaattttgaagactatcagagtgtaactcgttttctagacctcatacctcaggatact
ctggctgtagcgtcctttcgttccaaagcatacacacgagccgtaatgcactttgagtca
tttattacagaaaagaagcaaaatattcaaaagcatcttggatttctacagaaattgtat
gctgctatgcatgagccagatggagtggctggagtaagtgcaattcggaaagccgagcca
tccctgaaggaacagattcttgaacatgaaagtattggcttgctgagggatgccactgcc
tgttatgacagggctattcagctagaaccagaccagatcattcattatcatggtgttgtg
aagtccatgttaggtcttggtcagctgtctactgttatcacccaggtcaatggagtacat
gctaataggtctgaatggacagatgaattaaacacatacagagttgaagcagcttggaaa
ctgtcacagtgggatttggtggaaaactatttagcagcagacgggaaatccacaacatgg
agtgtcagactaggacagctactgttatcagctaaaaagagagacaccacaactttttat
gacacactgaagctagtgagagcagaacaaatcgtacctctctcagctgccagctttgaa
agaggctcctaccaacgaggctatgagtttattgtcagattacacatgttgtgtgagttg
gagcacagcctcaaaccgctttttcgcaagtctccaggtgacagttgtaatgaagactct
ctgaactggggagctcgacttgaaatgacccagaattcctatagagccaaggagcctatc
ctggccctccggagggctttattaagtctcaacaaaaggccggattacaatgaaatggtt
ggagaatgctggctacagagtgccagggtagctagaaaggctggccaccatcagacagcc
tacaatgctctccttaatgctggagagtcacgacttgctgaactgtatgtggagagggca
aagtggctgtggtccaagggtgacgttcaccaggcgcttattgttcttcaaaagggcgtg
gaattatgttttcctgaaaataagtccccatctgagagtaagcacatgctaatccatggc
cgggccacactgctagttggccgctttatggaagaaacggctaactttgaaagcaacgca
gtaatgaagaaatacaaggatgtgaccttgtttctgccagagtgggaagatggacatttc
taccttgccaagtactatgacaaattgatgccgatggtaacagataacaaaatggaaaag
caaggtgatctcatccgatatatagttttacattttggaagatctcttcagtatggaaat
cagttcatatatcagtcaatgccacgaatgttatcgctatggcttgattttggtgctaag
gcatacgaatgggaaaaaggtggtcgttctgatcgtctgcaaatgagaaatgatttggct
aaaataaatagtgtactcacagagcacacaaatcggttagcaccatatcagtttttgact
gctttttcgcagttgatctctcgaatatgtcattctcatgatgaagtttttgttgtcttg
atggaaataatagccaaggtatttctggcctatcctcagcaagcaatgtggatgatgact
gctgtgtcaaagtcttcttatcccatgcgtgtgaacagatgcaaggaaattcttaccaaa
gccatccatatgaaaaagtctttagaaaagtttgttggagatgcaactcgtttaacagac
aagctactagaattatgcaacaaatcggtcgatggaagcaattccacattaagcatgagc
actcactttaaaatgcttaaaaggcttgtagaagacccgaccttcagtgagatcctcatt
cccctgcagtcagtcatgatccctactcttccgtcagttctgggtgcccatgcgaatcat
gacccctttcctgggcactgggcctatcttgcaggcttcgatgatgtggtagaaattctt
tcttctcttcagaaaccaaagaaaatctctttaaagggctcagatggaaagttctacatc
atgatgtgtaaaccaaaagatgacttgagaaaagactgtagactaatggaattcaactct
ttgattaacaagagcttaagaaaagatgcagaatcacgtcgaagagaacttcatatccga
acatatgcagttattccactgaatgatgaatgtgggattattgaatgggtgaacaatact
gctggcttgagacctattctgaccaaaatatataaagaaaagggagtgtatatgacagga
aaggagcttcgccagtgtatgctaccaaagtcagcagctttatctgaaaaactcaaagta
ttccaagaattactcctgcccaggcatcctcctgtttttcatgagtggtttctgagaaca
ttccctgatcctacatcatggtacagtagcagatctgcatattgccgctctactgcagtc
atgtcaatggttggctacatcctggggcttggagaccgtcatggtgaaaacattcttttt
gactctttcactggtgaatgtgtacatgtagatttcaactgtctttttaataagggagaa
acgtttgaagttccggaaattgtaccatttcgactgactcataatatggttaatggaatg
ggtcctatgggaacagagggtctatttcgaagagcatgtgaagttacactgagactgatg
agggatcagagagaacctttaatgagtgtcttaaagacttttctacacgatcctctagtg
gagtggagtaaaccagtgaaaggacactccaaagcaccactgaatgaaaccggggaagtt
gtcaatgagaaggccaagacccatgttcttgacattgaacaacgactacaaggtgtgatc
aaaacccgaaatagagtaacagggctgccattatctattgaaggacatgtgcattacctc
atacaagaagctactgatgaaaacttactctgtcagatgtaccttggttggaccccatat
atgtaa

DBGET integrated database retrieval system