Mus musculus (house mouse): 12389 Help Entry 12389             CDS       T01002                                  Symbol Cav1, Cav, Cav-1 Name (RefSeq) caveolin 1, caveolae protein   KO K06278   caveolin 1 Organism mmu  Mus musculus (house mouse) Pathway mmu04144   Endocytosis mmu04510   Focal adhesion mmu05020   Prion disease mmu05100   Bacterial invasion of epithelial cells mmu05205   Proteoglycans in cancer mmu05416   Viral myocarditis mmu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mmu00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     12389 (Cav1)   09144 Cellular community - eukaryotes    04510 Focal adhesion     12389 (Cav1)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     12389 (Cav1)   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     12389 (Cav1)   09164 Neurodegenerative disease    05020 Prion disease     12389 (Cav1)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     12389 (Cav1)    05416 Viral myocarditis     12389 (Cav1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mmu04131]     12389 (Cav1) Membrane trafficking [BR:mmu04131]  Endocytosis   Lipid raft mediated endocytosis    Caveolin-mediated endocytosis     12389 (Cav1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Caveolin Motif Other DBs NCBI-GeneID:  12389 NCBI-ProteinID:  NP_031642 MGI:  102709 Ensembl:  ENSMUSG00000007655 UniProt:  P49817 LinkDB All DBs Position 6:17306287..17341327 Genome browser AA seq 178 aa AA seqDB search MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADEVTEKQVYDAHTKEIDLVNRDPKHLN DDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSTIFGIPMALIWGIYFA ILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPLFEAIGKIFSNIRISTQKEI NT seq 537 nt NT seq  +upstreamnt  +downstreamnt atgtctgggggcaaatacgtagactccgagggacatctctacactgttcccatccgggaa cagggcaacatctacaagcccaacaacaaggccatggcagacgaggtgactgagaagcaa gtgtatgacgcgcacaccaaggagattgacctggtcaaccgcgaccccaagcatctcaac gacgacgtggtcaagattgactttgaagatgtgattgcagaaccagaagggacacacagt ttcgacggcatctggaaggccagcttcaccaccttcactgtgacaaaatattggttttac cgcttgttgtctacgatcttcggcatcccaatggcactcatctggggcatttactttgcc attctctccttcctgcacatctgggcggttgtaccgtgcatcaagagcttcctgattgag attcagtgcatcagccgcgtctactccatctacgtccataccttctgcgatccactcttt gaagctattggcaagatattcagcaacatccgcatcagcacgcagaaagagatatga

Mus musculus (house mouse): 12390 Help Entry 12390             CDS       T01002                                  Symbol Cav2, AI447843 Name (RefSeq) caveolin 2   KO K12958   caveolin 2 Organism mmu  Mus musculus (house mouse) Pathway mmu04144   Endocytosis mmu04510   Focal adhesion mmu05020   Prion disease mmu05100   Bacterial invasion of epithelial cells mmu05205   Proteoglycans in cancer mmu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mmu00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     12390 (Cav2)   09144 Cellular community - eukaryotes    04510 Focal adhesion     12390 (Cav2)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     12390 (Cav2)   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     12390 (Cav2)   09164 Neurodegenerative disease    05020 Prion disease     12390 (Cav2)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     12390 (Cav2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mmu04131]     12390 (Cav2) Membrane trafficking [BR:mmu04131]  Endocytosis   Lipid raft mediated endocytosis    Caveolin-mediated endocytosis     12390 (Cav2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Caveolin SPC12 Motif Other DBs NCBI-GeneID:  12390 NCBI-ProteinID:  NP_058596 MGI:  107571 Ensembl:  ENSMUSG00000000058 UniProt:  Q9WVC3 LinkDB All DBs Position 6:17281184..17289129 Genome browser AA seq 162 aa AA seqDB search MGLETEKADVQLFMADDAYSHHSGVDYADPEKYVDSSHDRDPHQLNSHLKLGFEDLIAEP ETTHSFDKVWICSHALFEISKYVMYKFLTVFLAIPLAFIAGILFATLSCLHIWILMPFVK TCLMVLPSVQTIWKSVTDVVIGPLCTSVGRSFSSVSMQLSHD NT seq 489 nt NT seq  +upstreamnt  +downstreamnt atggggctggagaccgagaaggccgatgtgcagctcttcatggccgatgacgcctacagc caccacagtggcgttgactacgcagatcctgagaagtatgttgactcgagtcacgaccgg gatcctcaccagctcaactctcatctcaagctaggcttcgaggatctgattgcagagcct gagactacacactcctttgacaaagtgtggatctgcagccatgctctctttgaaatcagc aaatatgtgatgtacaagttcctgaccgtatttctggccatccccttggccttcattgcg ggtatcctgtttgctaccctcagctgtctgcacatctggatcctgatgccttttgtgaag acctgcctaatggtcttgccttccgtgcagacaatatggaagagtgtgacagacgttgtc attggcccattgtgtacaagtgtgggccgcagcttctcatcggtcagcatgcaactgagc cacgactga

Mus musculus (house mouse): 12391 Help Entry 12391             CDS       T01002                                  Symbol Cav3, AI385751, Cav-3, M-cav Name (RefSeq) caveolin 3   KO K12959   caveolin 3 Organism mmu  Mus musculus (house mouse) Pathway mmu04144   Endocytosis mmu04510   Focal adhesion mmu05020   Prion disease mmu05100   Bacterial invasion of epithelial cells mmu05205   Proteoglycans in cancer mmu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mmu00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     12391 (Cav3)   09144 Cellular community - eukaryotes    04510 Focal adhesion     12391 (Cav3)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     12391 (Cav3)   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     12391 (Cav3)   09164 Neurodegenerative disease    05020 Prion disease     12391 (Cav3)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     12391 (Cav3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mmu04131]     12391 (Cav3) Membrane trafficking [BR:mmu04131]  Endocytosis   Lipid raft mediated endocytosis    Caveolin-mediated endocytosis     12391 (Cav3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Caveolin Motif Other DBs NCBI-GeneID:  12391 NCBI-ProteinID:  NP_031643 MGI:  107570 Ensembl:  ENSMUSG00000062694 UniProt:  P51637 LinkDB All DBs Position 6:112436466..112449833 Genome browser AA seq 151 aa AA seqDB search MMTEEHTDLEARIIKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPEGTYSFDGVWKV SFTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHI YSLCIRTFCNPLFAALGQVCSNIKVVLRREG NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atgatgaccgaagagcacacggatctggaagctcggatcatcaaggacattcactgcaag gagatagacttggtgaaccgcgaccccaagaacatcaatgaggacattgtgaaggtagat tttgaagacgtgattgcggagcccgagggcacctacagcttcgacggtgtatggaaggtg agcttcaccacgttcaccgtctccaagtactggtgctaccgcctgttgtctacactgctg ggtgttccactggccctgctctggggattcctgttcgcctgtatctccttctgccacatc tgggccgtggtgccctgcattaagagctacctgatcgagatccagtgcatcagccacatc tactcactgtgtatccgcaccttctgcaacccgctcttcgctgcgttgggccaggtctgc agcaacattaaggtggtgctgcgaagggaaggctaa

DBGET integrated database retrieval system