KEGG   Mus musculus (house mouse): 12560
Entry
12560             CDS       T01002                                 
Symbol
Cdh3, AI385538, Cadp, Cdhp, P-cadherin, Pcad
Name
(RefSeq) cadherin 3
  KO
K06796  cadherin 3, type 1, P-cadherin
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    12560 (Cdh3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    12560 (Cdh3)
Cell adhesion molecules [BR:mmu04515]
 Cadherins
  Major cadherins
   12560 (Cdh3)
SSDB
Motif
Pfam: Cadherin CADH_Y-type_LIR Cadherin_3 Big_9 BACON_2 Cadherin_4
Other DBs
NCBI-GeneID: 12560
NCBI-ProteinID: NP_001032898
MGI: 88356
Ensembl: ENSMUSG00000061048
UniProt: P10287 Q8BRE1
Structure
LinkDB
Position
8:107237484..107283543
AA seq 822 aa
MELLSGPHAFLLLLLQVCWLRSVVSEPYRAGFIGEAGVTLEVEGTDLEPSQVLGKVALAG
QGMHHADNGDIIMLTRGTVQGGKDAMHSPPTRILRRRKREWVMPPIFVPENGKGPFPQRL
NQLKSNKDRGTKIFYSITGPGADSPPEGVFTIEKESGWLLLHMPLDREKIVKYELYGHAV
SENGASVEEPMNISIIVTDQNDNKPKFTQDTFRGSVLEGVMPGTSVMQVTATDEDDAVNT
YNGVVAYSIHSQEPKEPHDLMFTIHKSTGTISVISSGLDREKVPEYRLTVQATDMDGEGS
TTTAEAVVQILDANDNAPEFEPQKYEAWVPENEVGHEVQRLTVTDLDVPNSPAWRATYHI
VGGDDGDHFTITTHPETNQGVLTTKKGLDFEAQDQHTLYVEVTNEAPFAVKLPTATATVV
VHVKDVNEAPVFVPPSKVIEAQEGISIGELVCIYTAQDPDKEDQKISYTISRDPANWLAV
DPDSGQITAAGILDREDEQFVKNNVYEVMVLATDSGNPPTTGTGTLLLTLTDINDHGPIP
EPRQIIICNQSPVPQVLNITDKDLSPNSSPFQAQLTHDSDIYWMAEVSEKGDTVALSLKK
FLKQDTYDLHLSLSDHGNREQLTMIRATVCDCHGQVFNDCPRPWKGGFILPILGAVLALL
TLLLALLLLVRKKRKVKEPLLLPEDDTRDNVFYYGEEGGGEEDQDYDITQLHRGLEARPE
VVLRNDVVPTFIPTPMYRPRPANPDEIGNFIIENLKAANTDPTAPPYDSLLVFDYEGSGS
DAASLSSLTTSASDQDQDYNYLNEWGSRFKKLADMYGGGEDD
NT seq 2469 nt   +upstreamnt  +downstreamnt
atggagcttcttagtgggcctcacgccttcctgctcctcctgctccaggtttgctggcta
cgcagcgtggtctccgagccctaccgagcgggcttcatcggggaggctggagtgaccttg
gaggtggaaggaactgacctggagccgagccaagttctggggaaagtagccttggctgga
cagggcatgcaccatgcagacaatggagacatcattatgctgactagggggacagttcag
ggagggaaggatgcgatgcactccccacccacccgcatcttaaggagacgaaagagagag
tgggtgatgccaccaatattcgtccccgagaatggcaagggtcccttccctcagaggctg
aatcagctcaaatctaataaggacagaggcaccaagattttctacagcatcacagggcct
ggcgcagacagtccccccgaaggagtcttcaccatagagaaggagtcgggctggctgttg
ttgcatatgccactggacagggagaagattgtcaagtacgagctttatggccacgctgta
tctgagaatggtgcctctgtagaggagcccatgaacatatccatcattgtgacagaccag
aatgacaacaagcccaagttcactcaagacaccttcagagggagtgttctggagggagta
atgcctggcacttctgtgatgcaggtgacagccacagatgaggacgatgctgtcaacact
tacaatggggtggtggcttactccatccatagccaagagccgaaggagccacacgacctc
atgttcaccatccataaaagcacgggaaccattagcgtcatatccagtggcctggaccga
gagaaagtccctgagtacagactgaccgtccaggccacagacatggatggagagggctct
accacgacggcagaggccgttgtgcaaatccttgatgccaacgataacgctccggagttt
gagccgcagaagtatgaggcttgggtgcctgagaacgaagtgggccatgaggtacagagg
ctgacagtgactgatctcgatgtccccaactcgccagcgtggcgtgccacctaccacatc
gtgggaggtgatgatggggaccatttcaccatcaccactcacccagagaccaaccaaggc
gtcctgacaaccaagaagggtttggattttgaggctcaggaccaacacaccctgtatgta
gaagtgaccaacgaggctccctttgcagtgaagctcccgacagccactgccaccgtggtg
gtccatgtgaaagatgtcaacgaagcccctgtgtttgttccaccttccaaggtcattgag
gcccaggaaggcatctctattggggaactggtctgcatctataccgcacaggacccagac
aaggaggaccagaagatcagctacaccatctcgagagatccagccaactggcttgctgtg
gacccagacagtggtcagataactgccgcaggcatcttggatcgtgaggacgagcagttt
gtgaaaaacaatgtctacgaagtcatggttttggccacagacagtggaaaccctcccacc
accggcactgggaccctcctgcttacacttactgacatcaacgaccatggcccgatccct
gaacccaggcagatcatcatctgtaaccaaagccctgtgcctcaagtgctgaacatcact
gacaaggacctgtcccccaactcctcccctttccaggcccagctaacacatgactcagat
atctactggatggcagaagtcagcgagaaaggagacaccgtggccttgtccctgaagaag
ttcctgaaacaagacacgtatgacttgcatctttctttgtctgaccatggcaacagggaa
cagctaaccatgatcagggccactgtgtgtgactgccatggccaagtgttcaatgactgc
cccagaccctggaagggtggtttcatcctccccatcctgggtgctgtcctggcactgctg
acccttctactggcactcctcctgttggtgaggaagaagaggaaggtcaaagagcccctt
ctgctcccagaagatgacacgcgagacaatgtcttctattatggagaagagggtggtggt
gaagaggaccaggactatgacatcacccaactccaccggggactggaggccaggcctgag
gtggttctccgaaacgatgtagtgccaaccttcatccccacccccatgtaccgaccccgg
cccgccaacccagatgaaatcgggaacttcatcatcgagaacctgaaggctgccaacact
gaccctactgccccgccctacgactccctgctggtttttgactacgagggcagcggctct
gatgccgcctccctgagctccctcaccacctccgcctccgaccaggatcaggactacaac
taccttaacgagtggggaagtcgattcaagaaactggcggacatgtatggtggcggtgag
gatgactag

DBGET integrated database retrieval system