Mus musculus (house mouse): 12567 Help Entry 12567             CDS       T01002                                  Symbol Cdk4, Crk3 Name (RefSeq) cyclin dependent kinase 4   KO K02089   cyclin-dependent kinase 4 [EC:2.7.11.22] Organism mmu  Mus musculus (house mouse) Pathway mmu01522   Endocrine resistance mmu04110   Cell cycle mmu04115   p53 signaling pathway mmu04151   PI3K-Akt signaling pathway mmu04218   Cellular senescence mmu04530   Tight junction mmu04660   T cell receptor signaling pathway mmu04933   AGE-RAGE signaling pathway in diabetic complications mmu04934   Cushing syndrome mmu05160   Hepatitis C mmu05162   Measles mmu05163   Human cytomegalovirus infection mmu05164   Influenza A mmu05165   Human papillomavirus infection mmu05166   Human T-cell leukemia virus 1 infection mmu05167   Kaposi sarcoma-associated herpesvirus infection mmu05169   Epstein-Barr virus infection mmu05200   Pathways in cancer mmu05203   Viral carcinogenesis mmu05212   Pancreatic cancer mmu05214   Glioma mmu05218   Melanoma mmu05219   Bladder cancer mmu05220   Chronic myeloid leukemia mmu05222   Small cell lung cancer mmu05223   Non-small cell lung cancer mmu05224   Breast cancer mmu05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:mmu00001]  09130 Environmental Information Processing   09132 Signal transduction    04151 PI3K-Akt signaling pathway     12567 (Cdk4)  09150 Organismal Systems   09151 Immune system    04660 T cell receptor signaling pathway     12567 (Cdk4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     12567 (Cdk4)    05203 Viral carcinogenesis     12567 (Cdk4)   09162 Cancer: specific types    05212 Pancreatic cancer     12567 (Cdk4)    05225 Hepatocellular carcinoma     12567 (Cdk4)    05214 Glioma     12567 (Cdk4)    05220 Chronic myeloid leukemia     12567 (Cdk4)    05218 Melanoma     12567 (Cdk4)    05219 Bladder cancer     12567 (Cdk4)    05224 Breast cancer     12567 (Cdk4)    05222 Small cell lung cancer     12567 (Cdk4)    05223 Non-small cell lung cancer     12567 (Cdk4)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     12567 (Cdk4)    05160 Hepatitis C     12567 (Cdk4)    05164 Influenza A     12567 (Cdk4)    05162 Measles     12567 (Cdk4)    05163 Human cytomegalovirus infection     12567 (Cdk4)    05167 Kaposi sarcoma-associated herpesvirus infection     12567 (Cdk4)    05169 Epstein-Barr virus infection     12567 (Cdk4)    05165 Human papillomavirus infection     12567 (Cdk4)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     12567 (Cdk4)    04934 Cushing syndrome     12567 (Cdk4)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     12567 (Cdk4)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:mmu01001]     12567 (Cdk4) Enzymes [BR:mmu01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.22  cyclin-dependent kinase      12567 (Cdk4) Protein kinases [BR:mmu01001]  Serine/threonine kinases: CMGC group   CDK family    12567 (Cdk4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH Haspin_kinase ABC1 Kdo Kinase-like Motif Other DBs NCBI-GeneID:  12567 NCBI-ProteinID:  NP_034000 MGI:  88357 Ensembl:  ENSMUSG00000006728 UniProt:  P30285 Q545C3 LinkDB All DBs Position 10:126899404..126903157 Genome browser AA seq 303 aa AA seqDB search MAATRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGAAGGGLPVSTVREVALL RRLEAFEHPNVVRLMDVCATSRTDRDIKVTLVFEHIDQDLRTYLDKAPPPGLPVETIKDL MRQFLSGLDFLHANCIVHRDLKPENILVTSNGTVKLADFGLARIYSYQMALTPVVVTLWY RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR EVSLPRGAFAPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKEES DAE NT seq 912 nt NT seq  +upstreamnt  +downstreamnt atggctgccactcgatatgaacccgtggctgaaattggtgtcggtgcctatgggacggtg tacaaagcccgagatccccacagtggccactttgtggccctcaagagtgtgagagttcct aatggaggagcagctggagggggccttcccgtcagcacagttcgtgaggtggccttgtta aggaggctggaggcctttgaacatcccaatgttgtacggctgatggatgtctgtgctact tcccgaactgatcgggacatcaaggtcaccctagtgtttgagcatatagaccaggacctg aggacatacctggacaaagcacctccaccgggcctgccggttgagaccattaaggatcta atgcgtcagtttctaagcggcctggattttcttcatgcaaactgcattgttcaccgggac ctgaagccagagaacattctagtgacaagtaatgggaccgtcaagctggctgactttggc ctagctagaatctacagctaccagatggccctcacgcctgtggtggttacgctctggtac cgagctcctgaagttcttctgcagtctacatacgcaacacccgtggacatgtggagcgtt ggctgtatctttgcagagatgttccgtcggaagcctctcttctgtggaaactctgaagcc gaccagttggggaaaatctttgatctcattggattgcctccagaagacgactggcctcga gaggtatctctacctcgaggagcctttgcccccagagggcctcggccagtgcagtcagtg gtgccagagatggaggagtctggagcgcagctgctactggaaatgctgacctttaaccca cataagcgaatctctgccttccgagccctgcagcactcctacctgcacaaggaggaaagc gacgcagagtga

Mus musculus (house mouse): 12571 Help Entry 12571             CDS       T01002                                  Symbol Cdk6, Crk2 Name (RefSeq) cyclin dependent kinase 6   KO K02091   cyclin-dependent kinase 6 [EC:2.7.11.22] Organism mmu  Mus musculus (house mouse) Pathway mmu04110   Cell cycle mmu04115   p53 signaling pathway mmu04151   PI3K-Akt signaling pathway mmu04218   Cellular senescence mmu04934   Cushing syndrome mmu05160   Hepatitis C mmu05162   Measles mmu05163   Human cytomegalovirus infection mmu05164   Influenza A mmu05165   Human papillomavirus infection mmu05167   Kaposi sarcoma-associated herpesvirus infection mmu05169   Epstein-Barr virus infection mmu05200   Pathways in cancer mmu05203   Viral carcinogenesis mmu05206   MicroRNAs in cancer mmu05212   Pancreatic cancer mmu05214   Glioma mmu05218   Melanoma mmu05220   Chronic myeloid leukemia mmu05222   Small cell lung cancer mmu05223   Non-small cell lung cancer mmu05224   Breast cancer mmu05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:mmu00001]  09130 Environmental Information Processing   09132 Signal transduction    04151 PI3K-Akt signaling pathway     12571 (Cdk6)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     12571 (Cdk6)    05206 MicroRNAs in cancer     12571 (Cdk6)    05203 Viral carcinogenesis     12571 (Cdk6)   09162 Cancer: specific types    05212 Pancreatic cancer     12571 (Cdk6)    05225 Hepatocellular carcinoma     12571 (Cdk6)    05214 Glioma     12571 (Cdk6)    05220 Chronic myeloid leukemia     12571 (Cdk6)    05218 Melanoma     12571 (Cdk6)    05224 Breast cancer     12571 (Cdk6)    05222 Small cell lung cancer     12571 (Cdk6)    05223 Non-small cell lung cancer     12571 (Cdk6)   09172 Infectious disease: viral    05160 Hepatitis C     12571 (Cdk6)    05164 Influenza A     12571 (Cdk6)    05162 Measles     12571 (Cdk6)    05163 Human cytomegalovirus infection     12571 (Cdk6)    05167 Kaposi sarcoma-associated herpesvirus infection     12571 (Cdk6)    05169 Epstein-Barr virus infection     12571 (Cdk6)    05165 Human papillomavirus infection     12571 (Cdk6)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     12571 (Cdk6)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:mmu01001]     12571 (Cdk6) Enzymes [BR:mmu01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.22  cyclin-dependent kinase      12571 (Cdk6) Protein kinases [BR:mmu01001]  Serine/threonine kinases: CMGC group   CDK family    12571 (Cdk6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr ABC1 APH Kdo Haspin_kinase RIO1 Kinase-like FTA2 Uricase Motif Other DBs NCBI-GeneID:  12571 NCBI-ProteinID:  NP_034003 MGI:  1277162 Ensembl:  ENSMUSG00000040274 UniProt:  Q64261 Q0VBK8 LinkDB All DBs Position 5:3391004..3581008 Genome browser AA seq 326 aa AA seqDB search MEKDSLSRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTSEEGMPLSTIR EVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTE TIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVV VTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDIIGLPGE EDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYGALNHPYF QDLERYKDNLNSHLPSNQSTSELNTA NT seq 981 nt NT seq  +upstreamnt  +downstreamnt atggagaaggacagcctgagtcgcgccgatcagcagtatgagtgcgtggcggagatcggc gaaggcgcctatgggaaggtgttcaaggcccgcgacctgaagaacggcggccgcttcgtg gctctgaagcgcgtgcgagtgcagaccagtgaggagggcatgccgctctccaccatccgc gaggtggcggtgctgaggcacctggagaccttcgagcaccccaacgtggtcaggttgttt gatgtgtgcacagtgtcacggacggacagagaaaccaagcttacactagtgtttgagcat gttgatcaagacttgaccacttacttggataaagttccagagcccggcgtacccacagaa accataaaggatatgatgtttcagcttctccgaggtctggactttcttcattctcacaga gtagtgcatcgtgatctgaaaccgcagaacattctggtgaccagcagtggacagataaag ctggctgactttggccttgcccgcatctatagttttcagatggcccttacctcggtggtc gtcacgctgtggtaccgagccccagaagtcctgctccagtccagctatgccacccctgtg gacctctggagtgtcggttgcatctttgcagaaatgtttcgcagaaagcctctttttcgt ggaagttcagacgtggatcaactaggaaaaatcttggacatcattggactcccaggagag gaagactggcctagggacgtggcccttccccggcaggcttttcattccaaatctgctcaa cccatcgagaagtttgtgacagatattgacgaactaggcaaagacctacttctgaaatgc ctgacgtttaatccagctaaaaggatatccgcctacggcgccctgaatcacccgtacttc caagatctggagagatacaaggacaacctgaactctcacctgccatccaaccagagcacc tcggagctgaacacagcctga

DBGET integrated database retrieval system