KEGG   Mus musculus (mouse): 12575Help
Entry
12575             CDS       T01002                                 

Gene name
Cdkn1a, CAP20, CDKI, CIP1, Cdkn1, P21, SDI1, Waf1, mda6, p21Cip1, p21WAF
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1A (P21)
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01522  Endocrine resistance
mmu01524  Platinum drug resistance
mmu04012  ErbB signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04068  FoxO signaling pathway
mmu04110  Cell cycle
mmu04115  p53 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04218  Cellular senescence
mmu04630  Jak-STAT signaling pathway
mmu04921  Oxytocin signaling pathway
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04934  Cushing syndrome
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05169  Epstein-Barr virus infection
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05203  Viral carcinogenesis
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
mmu05210  Colorectal cancer
mmu05211  Renal cell carcinoma
mmu05212  Pancreatic cancer
mmu05213  Endometrial cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05216  Thyroid cancer
mmu05217  Basal cell carcinoma
mmu05218  Melanoma
mmu05219  Bladder cancer
mmu05220  Chronic myeloid leukemia
mmu05222  Small cell lung cancer
mmu05223  Non-small cell lung cancer
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    12575 (Cdkn1a)
   04630 Jak-STAT signaling pathway
    12575 (Cdkn1a)
   04066 HIF-1 signaling pathway
    12575 (Cdkn1a)
   04068 FoxO signaling pathway
    12575 (Cdkn1a)
   04151 PI3K-Akt signaling pathway
    12575 (Cdkn1a)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    12575 (Cdkn1a)
   04115 p53 signaling pathway
    12575 (Cdkn1a)
   04218 Cellular senescence
    12575 (Cdkn1a)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    12575 (Cdkn1a)
   04928 Parathyroid hormone synthesis, secretion and action
    12575 (Cdkn1a)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    12575 (Cdkn1a)
   05202 Transcriptional misregulation in cancer
    12575 (Cdkn1a)
   05206 MicroRNAs in cancer
    12575 (Cdkn1a)
   05205 Proteoglycans in cancer
    12575 (Cdkn1a)
   05203 Viral carcinogenesis
    12575 (Cdkn1a)
  09162 Cancers: Specific types
   05210 Colorectal cancer
    12575 (Cdkn1a)
   05212 Pancreatic cancer
    12575 (Cdkn1a)
   05225 Hepatocellular carcinoma
    12575 (Cdkn1a)
   05226 Gastric cancer
    12575 (Cdkn1a)
   05214 Glioma
    12575 (Cdkn1a)
   05216 Thyroid cancer
    12575 (Cdkn1a)
   05220 Chronic myeloid leukemia
    12575 (Cdkn1a)
   05217 Basal cell carcinoma
    12575 (Cdkn1a)
   05218 Melanoma
    12575 (Cdkn1a)
   05211 Renal cell carcinoma
    12575 (Cdkn1a)
   05219 Bladder cancer
    12575 (Cdkn1a)
   05215 Prostate cancer
    12575 (Cdkn1a)
   05213 Endometrial cancer
    12575 (Cdkn1a)
   05224 Breast cancer
    12575 (Cdkn1a)
   05222 Small cell lung cancer
    12575 (Cdkn1a)
   05223 Non-small cell lung cancer
    12575 (Cdkn1a)
  09167 Endocrine and metabolic diseases
   04934 Cushing syndrome
    12575 (Cdkn1a)
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    12575 (Cdkn1a)
   05161 Hepatitis B
    12575 (Cdkn1a)
   05160 Hepatitis C
    12575 (Cdkn1a)
   05163 Human cytomegalovirus infection
    12575 (Cdkn1a)
   05167 Kaposi sarcoma-associated herpesvirus infection
    12575 (Cdkn1a)
   05169 Epstein-Barr virus infection
    12575 (Cdkn1a)
   05165 Human papillomavirus infection
    12575 (Cdkn1a)
  09176 Drug resistance: Antineoplastic
   01524 Platinum drug resistance
    12575 (Cdkn1a)
   01522 Endocrine resistance
    12575 (Cdkn1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CDI
Motif
Other DBs
NCBI-GeneID: 12575
NCBI-ProteinID: NP_001104569
MGI: 104556
Ensembl: ENSMUSG00000023067
Vega: OTTMUSG00000031654
UniProt: P39689 Q564P6
LinkDB All DBs
Position
17 A3.3; 17 15.12 cM
AA seq 159 aa AA seqDB search
MSNPGDVRPVPHRSKVCRCLFGPVDSEQLRRDCDALMAGCLQEARERWNFDFVTETPLEG
NFVWERVRSLGLPKVYLSPGSRSRDDLGGDKRPSTSSALLQGPAPEDHVALSLSCTLVSE
RPEDSPGGPGTSQGRKRRQTSLTDFYHSKRRLVFCKRKP
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgtccaatcctggtgatgtccgacctgttccgcacaggagcaaagtgtgccgttgtctc
ttcggtcccgtggacagtgagcagttgcgccgtgattgcgatgcgctcatggcgggctgt
ctccaggaggcccgagaacggtggaactttgacttcgtcacggagacgccgctggagggc
aacttcgtctgggagcgcgttcggagcctagggctgcccaaggtctacctgagccctggg
tcccgcagccgtgacgacctgggaggggacaagaggcccagtacttcctctgccctgctg
caggggccagctccggaggaccacgtggccttgtcgctgtcttgcactctggtgtctgag
cggcctgaagattccccgggtgggcccggaacatctcagggccgaaaacggaggcagacc
agcctgacagatttctatcactccaagcgcagattggtcttctgcaagagaaaaccctga

DBGET integrated database retrieval system