KEGG   Mus musculus (house mouse): 12608
Entry
12608             CDS       T01002                                 
Symbol
Cebpb, C/EBPbeta, CRP2, IL-6DBP, LAP, LIP, NF-IL6, NF-M, Nfil6
Name
(RefSeq) CCAAT/enhancer binding protein (C/EBP), beta
  KO
K10048  CCAAT/enhancer binding protein (C/EBP), beta
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04657  IL-17 signaling pathway
mmu04668  TNF signaling pathway
mmu05152  Tuberculosis
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    12608 (Cebpb)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    12608 (Cebpb)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    12608 (Cebpb)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    12608 (Cebpb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    12608 (Cebpb)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   C/EBP-like factors
    12608 (Cebpb)
SSDB
Motif
Pfam: bZIP_2 bZIP_1 CCD48 Taxilin DUF3450 Nup54 Uds1 UPF0242 bZIP_Maf
Other DBs
NCBI-GeneID: 12608
NCBI-ProteinID: NP_034013
MGI: 88373
Ensembl: ENSMUSG00000056501
UniProt: P28033 Q3UPN9
Structure
LinkDB
Position
2:167530835..167532352
AA seq 296 aa
MHRLLAWDAACLPPPPAAFRPMEVANFYYEPDCLAYGAKAARAAPRAPAAEPAIGEHERA
IDFSPYLEPLAPAADFAAPAPAHHDFLSDLFADDYGAKPSKKPADYGYVSLGRAGAKAAP
PACFPPPPPAALKAEPGFEPADCKRADDAPAMAAGFPFALRAYLGYQATPSGSSGSLSTS
SSSSPPGTPSPADAKAAPAACFAGPPAAPAKAKAKKTVDKLSDEYKMRRERNNIAVRKSR
DKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASAGHC
NT seq 891 nt   +upstreamnt  +downstreamnt
atgcaccgcctgctggcctgggacgcagcatgcctcccgccgccgcccgccgcctttaga
cccatggaagtggccaacttctactacgagcccgactgcctggcctacggggccaaggcg
gcccgcgccgcgccgcgcgcccccgccgccgagccggccattggcgagcacgagcgcgcc
atcgacttcagcccctacctggagccgctcgcgcccgccgcggacttcgccgcgcccgcg
cccgcgcaccacgacttcctctccgacctcttcgccgacgactacggcgccaagccgagc
aagaagccggccgactacggttacgtgagcctcggccgcgcgggcgccaaggccgcgccg
cccgcctgcttcccgccgccgcctcccgccgcgctcaaggcggagccgggcttcgaaccc
gcggactgcaagcgcgcggacgacgcgcccgccatggcggccggtttcccgttcgccctg
cgcgcctacctgggctaccaggcgacgccgagcggcagcagcggcagcctgtccacgtcg
tcgtcgtccagcccgcccggcacgccgagccccgccgacgccaaggccgcgcccgccgcc
tgcttcgcggggccgccggccgcgcccgccaaggccaaggccaagaagacggtggacaag
ctgagcgacgagtacaagatgcggcgcgagcgcaacaacatcgcggtgcgcaagagccgc
gacaaggccaagatgcgcaacctggagacgcagcacaaggtgctggagctgacggcggag
aacgagcggctgcagaagaaggtggagcagctgtcgcgagagctcagcaccctgcggaac
ttgttcaagcagctgcccgagccgctgctggcctcggcgggccactgctag

DBGET integrated database retrieval system