KEGG   Mus musculus (house mouse): 12777
Entry
12777             CDS       T01002                                 
Symbol
Ccr10, C-C_CKR-10, CC-CKR-10, CCR-10, Cmkbr9, Gpr2
Name
(RefSeq) chemokine (C-C motif) receptor 10
  KO
K04185  C-C chemokine receptor type 10
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04062  Chemokine signaling pathway
mmu04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    12777 (Ccr10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    12777 (Ccr10)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    12777 (Ccr10)
   04062 Chemokine signaling pathway
    12777 (Ccr10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    12777 (Ccr10)
   04050 Cytokine receptors [BR:mmu04050]
    12777 (Ccr10)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    12777 (Ccr10)
Cytokine receptors [BR:mmu04050]
 Chemokine receptors
  CC Chemokine
   12777 (Ccr10)
SSDB
Motif
Pfam: 7tm_1 V1R 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 12777
NCBI-ProteinID: NP_031747
MGI: 1096320
Ensembl: ENSMUSG00000044052
UniProt: Q9JL21
LinkDB
Position
11:complement(101063824..101066269)
AA seq 362 aa
MGTKPTEQVSWGLYSGYDEEAYSVGPLPELCYKADVQAFSRAFQPSVSLMVAVLGLAGNG
LVLATHLAARRTTRSPTSVHLLQLALADLLLALTLPFAAAGALQGWNLGSTTCRAISGLY
SASFHAGFLFLACISADRYVAIARALPAGQRPSTPSRAHLVSVFVWLLSLFLALPALLFS
RDGPREGQRRCRLIFPESLTQTVKGASAVAQVVLGFALPLGVMAACYALLGRTLLAARGP
ERRRALRVVVALVVAFVVLQLPYSLALLLDTADLLAARERSCSSSKRKDLALLVTGGLTL
VRCSLNPVLYAFLGLRFRRDLRRLLQGGGCSPKPNPRGRCPRRLRLSSCSAPTETHSLSW
DN
NT seq 1089 nt   +upstreamnt  +downstreamnt
atggggaccaagcccacagagcaggtctcctggggactttactccgggtacgatgaggag
gcctattcggttgggccgctgccagagctctgttacaaggctgatgtccaggctttcagt
cgggccttccaacccagtgtctccctgatggtggctgtactgggtctggctggcaatggc
ctagtcttggccacccatctggcagccagacgaactacccgatctcccacctccgttcac
ctgctccagttggccctggctgaccttttattggccctgactttgccttttgctgcagca
ggggctcttcagggctggaatctaggaagtaccacctgccgtgccatctcaggcctctac
tcggcctctttccacgctggcttcctcttcctagcctgtatcagcgccgaccgctatgtg
gccatcgcacgagctctcccagccgggcagcggccctcaacgcctagccgagcgcacttg
gtttcagtcttcgtgtggctgttgtcgctgtttctggctctacctgcgctccttttcagc
cgggacgggccacgtgaaggccaacgacgctgtcggctcatttttcccgaaagcctcacg
cagactgtgaaaggggcaagcgcagtggcgcaggtggtcctcggcttcgcgctccctctg
ggcgtcatggcagcctgttatgcgctcctgggccgcacgcttctggccgccagggggcca
gagcggcggcgtgcactgcgcgtcgtggtggctttggtggtggccttcgtggtgctgcag
ttgccctacagccttgccctgctgctggatacagccgatctactggcagcccgcgagcgg
agctgctcctccagcaagcgcaaggatctagctttgctggtcaccggcggcttgaccctg
gtccgttgcagcctcaatccggtgctttatgcctttttgggcctgcgtttccgccgggac
ctgcggaggctgctccagggcggaggatgcagcccgaagcccaaccctcgtggccgctgc
ccccgtcgactccgcctttcttcctgctctgctcctactgagacccacagtctctcttgg
gacaactag

DBGET integrated database retrieval system