KEGG   Mus musculus (house mouse): 13866
Entry
13866             CDS       T01002                                 
Symbol
Erbb2, Erbb-2, HER-2, HER2, Neu, c-erbB2, c-neu, l11Jus8, mKIAA3023
Name
(RefSeq) erb-b2 receptor tyrosine kinase 2
  KO
K05083  receptor tyrosine-protein kinase erbB-2 [EC:2.7.10.1]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu01522  Endocrine resistance
mmu01524  Platinum drug resistance
mmu04010  MAPK signaling pathway
mmu04012  ErbB signaling pathway
mmu04020  Calcium signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04520  Adherens junction
mmu04530  Tight junction
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
mmu05212  Pancreatic cancer
mmu05213  Endometrial cancer
mmu05215  Prostate cancer
mmu05219  Bladder cancer
mmu05223  Non-small cell lung cancer
mmu05224  Breast cancer
mmu05226  Gastric cancer
mmu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    13866 (Erbb2)
   04012 ErbB signaling pathway
    13866 (Erbb2)
   04066 HIF-1 signaling pathway
    13866 (Erbb2)
   04020 Calcium signaling pathway
    13866 (Erbb2)
   04151 PI3K-Akt signaling pathway
    13866 (Erbb2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    13866 (Erbb2)
   04520 Adherens junction
    13866 (Erbb2)
   04530 Tight junction
    13866 (Erbb2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    13866 (Erbb2)
   05206 MicroRNAs in cancer
    13866 (Erbb2)
   05205 Proteoglycans in cancer
    13866 (Erbb2)
   05230 Central carbon metabolism in cancer
    13866 (Erbb2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    13866 (Erbb2)
   05226 Gastric cancer
    13866 (Erbb2)
   05219 Bladder cancer
    13866 (Erbb2)
   05215 Prostate cancer
    13866 (Erbb2)
   05213 Endometrial cancer
    13866 (Erbb2)
   05224 Breast cancer
    13866 (Erbb2)
   05223 Non-small cell lung cancer
    13866 (Erbb2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    13866 (Erbb2)
   01524 Platinum drug resistance
    13866 (Erbb2)
   01522 Endocrine resistance
    13866 (Erbb2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    13866 (Erbb2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    13866 (Erbb2)
   04090 CD molecules [BR:mmu04090]
    13866 (Erbb2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     13866 (Erbb2)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   13866 (Erbb2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   13866 (Erbb2)
CD molecules [BR:mmu04090]
 Proteins
  13866 (Erbb2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Haspin_kinase DUF5849 Kinase-like PDGLE GAPT
Other DBs
NCBI-GeneID: 13866
NCBI-ProteinID: NP_001003817
MGI: 95410
Ensembl: ENSMUSG00000062312
UniProt: P70424
LinkDB
Position
11:98303310..98328542
AA seq 1256 aa
MELAAWCRWGFLLALLSPGAAGTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNL
ELTYLPANASLSFLQDIQEVQGYMLIAHNRVKHVPLQRLRIVRGTQLFEDKYALAVLDNR
DPLDNVTTAAPGRTPEGLRELQLRSLTEILKGGVLIRGNPQLCYQDMVLWKDVLRKNNQL
APVDMDTNRSRACPPCAPTCKDNHCWGESPEDCQILTGTICTSGCARCKGRLPTDCCHEQ
CAAGCTGPKHSDCLACLHFNHSGICELHCPALITYNTDTFESMLNPEGRYTFGASCVTTC
PYNYLSTEVGSCTLVCPPNNQEVTAEDGTQRCEKCSKPCAGVCYGLGMEHLRGARAITSD
NIQEFAGCKKIFGSLAFLPESFDGNPSSGVAPLKPEHLQVFETLEEITGYLYISAWPESF
QDLSVFQNLRVIRGRILHDGAYSLTLQGLGIHSLGLRSLRELGSGLALIHRNTHLCFVNT
VPWDQLFRNPHQALLHSGNRPEEACGLEGLVCNSLCARGHCWGPGPTQCVNCSQFLRGQE
CVEECRVWKGLPREYVRGKHCLPCHPECQPQNSSETCYGSEADQCEACAHYKDSSSCVAR
CPSGVKPDLSYMPIWKYPDEEGICQPCPINCTHSCVDLDERGCPAEQRASPVTFIIATVV
GVLLFLIIVVVIGILIKRRRQKIRKYTMRRLLQETELVEPLTPSGAVPNQAQMRILKETE
LRKLKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGS
PYVSRLLGICLTSTVQLVTQLMPYGCLLDHVREHRGRLGSQDLLNWCVQIAKGMSYLEEV
RLVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRF
THQSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCW
MIDSECRPRFRELVSEFSRMARDPQRFVVIQNEDLGPSSPMDSTFYRSLLEDDDMGELVD
AEEYLVPQQGFFSPDPALGTGSTAHRRHRSSSARSGGGELTLGLEPSEEEPPRSPLAPSE
GAGSDVFDGDLAVGVTKGLQSLSPHDLSPLQRYSEDPTLPLPPETDGYVAPLACSPQPEY
VNQPEVRPQSPLTPEGPPPPIRPAGATLERPKTLSPGKNGVVKDVFAFGGAVENPEYLAP
RAGTASQPHPSPAFSPAFDNLYYWDQNSSEQGPPPSTFEGTPTAENPEYLGLDVPV
NT seq 3771 nt   +upstreamnt  +downstreamnt
atggagctggcggcctggtgccgttgggggttcctcctcgccctcctgtcccccggagcc
gcgggtacccaagtgtgtaccggtaccgacatgaagttgcgactccctgccagtcctgag
acccacctggacatgcttcgccacctctaccagggctgtcaggtggtgcagggcaatttg
gagcttacctacctgcccgccaatgccagcctctcattcctgcaggacatccaggaagtc
cagggatacatgctcatcgctcacaaccgagtgaaacacgtcccactgcagaggttgcgc
atcgtgagagggactcagctctttgaggacaagtatgccctggctgtgctagacaaccga
gaccctttggacaacgtcaccaccgccgccccaggcagaaccccagaagggctgcgggag
ctgcagcttcgaagtctcacagagatcttgaagggaggagttttgatccgtgggaaccct
cagctctgctaccaggacatggttttgtggaaggatgtcctccgtaagaataaccagctg
gctcctgtcgacatggacaccaatcgttcccgggcctgtccaccttgtgccccaacctgc
aaagacaatcactgttggggtgagagtcctgaagactgtcagatcttgactggcaccatc
tgtactagtggctgtgcccggtgcaagggccggctgcccactgactgttgccatgagcag
tgtgctgcaggctgcacgggtcccaagcattctgactgcctggcctgcctccacttcaat
catagtggtatctgtgagctgcactgcccggccctcatcacctacaacacagacaccttc
gagtccatgctcaaccctgagggtcgctacacctttggtgccagctgtgtgaccacctgc
ccctacaactacctctccacggaagtgggatcctgcactctggtctgtcccccgaacaac
caagaggtcacagctgaggacggaacacagcggtgtgagaaatgcagcaagccctgtgct
ggagtatgctatggtctgggcatggagcacctccgaggggcgagggccatcaccagtgac
aatatccaggagtttgctggctgcaagaagatctttgggagcctggcatttttgccggag
agctttgatgggaacccctcctccggcgttgccccactgaagccagagcatctccaagtg
ttcgaaaccctggaggagatcacaggttacctatacatttcagcatggccagagagcttc
caagacctcagtgtcttccagaaccttcgggtcattcggggacggattctccatgatggt
gcttactcattgacgttgcaaggcctggggattcactcactggggctacgctcactgcgg
gagctgggcagtggattggctctcattcaccgcaacacccatctctgctttgtaaacact
gtaccttgggaccagctcttccggaacccgcaccaggccctactccacagtgggaaccgg
ccagaagaggcatgtggtcttgagggcttggtctgtaactcactgtgtgcccgtgggcac
tgctgggggccagggcccacccagtgtgtcaactgcagtcagttcctccggggccaggag
tgtgtggaggagtgccgagtatggaaggggctccccagggagtatgtgaggggcaagcac
tgtctgccatgccaccccgagtgtcagcctcaaaacagctcggagacctgctatggatcg
gaggctgaccagtgtgaggcttgtgcccactacaaggactcatcttcctgtgtggctcgc
tgccccagtggtgtgaagccagacctctcctacatgcctatctggaagtacccggatgag
gagggcatatgtcagccatgccccatcaactgcacccactcatgtgtggacctggacgaa
cgaggctgcccagcagagcagagagccagcccagtgacattcatcattgcaactgtggtg
ggcgtcctgttgttcctgatcatagtggtggtcattggaatcctaatcaaacgaaggcga
cagaagatccggaagtataccatgcgtaggctgctgcaggagaccgagctggtggagccg
ctgacgcccagtggagctgtgcccaaccaggctcagatgcggatcctaaaggagacagag
ctaaggaagctgaaggtgcttgggtcaggagccttcggcactgtctacaagggcatctgg
atcccagatggggagaacgtgaaaatccccgtggccatcaaggtgttgagggaaaacaca
tctcctaaagctaacaaagaaatcctagatgaagcgtacgtcatggctggtgtgggttct
ccatatgtgtcccgcctcctgggcatctgcctgacatccacagtgcagctggtgacacag
cttatgccctatggctgccttctggaccatgtccgagaacaccgaggtcgcttaggctcc
caggacctgctcaactggtgtgttcagattgccaaggggatgagctacctggaggaagtt
cggcttgttcacagggacctagctgcccgaaacgtgctagtcaagagtcccaaccacgtc
aagattaccgacttcgggctggcacggctgctggacattgatgagactgaataccatgca
gatgggggcaaggtgcccatcaagtggatggcattggaatctattctcagacgccggttc
acccatcagagtgatgtgtggagctatggtgtgactgtgtgggagctgatgacctttggg
gccaaaccttacgatgggatcccagctcgggagatccctgatttgctggagaagggagaa
cgcctacctcagcctccaatctgcaccatcgacgtctacatgatcatggtcaaatgttgg
atgattgactccgaatgtcgcccgagattccgggagttggtatcagaattctcccgtatg
gcaagggacccccagcgctttgtggtcatccagaacgaggacttaggcccctccagcccc
atggacagcaccttctaccgttcactgctggaggatgatgacatgggggagctggtcgat
gctgaagagtacctggtaccccagcagggattcttctccccagaccctgccctaggtact
gggagcacagcccaccgcagacaccgcagctcgtcggccaggagtggcggtggtgagctg
acactgggcctggagccctcggaagaagagccccccagatctccactggctccctccgaa
ggggctggctccgatgtgtttgatggtgacctggcagtgggggtaaccaaaggactgcag
agcctctctccacatgacctcagccctctacagcggtacagtgaggatcccacattacct
ctgccccccgagactgatggctacgttgctcccctggcctgcagcccccagcccgagtat
gtgaaccagccagaggttcggcctcagtctcccttgaccccagagggtcctccgcctccc
atccgacctgctggtgctactctagaaagacccaagactctctctcctgggaaaaatggg
gttgtcaaagacgtttttgcctttgggggtgctgtggagaaccctgaatacttagcaccc
agagcaggcactgcctctcagccccacccttctcctgccttcagcccagcctttgacaac
ctctattactgggaccagaactcatcggagcagggtcctccaccaagtacctttgaaggg
acccccactgcagagaaccctgagtacctaggcctggatgtgccagtatga

KEGG   Mus musculus (house mouse): 13867
Entry
13867             CDS       T01002                                 
Symbol
Erbb3, C76256, Erbb-3, Erbb3r, Her3
Name
(RefSeq) erb-b2 receptor tyrosine kinase 3
  KO
K05084  receptor tyrosine-protein kinase erbB-3 [EC:2.7.10.1]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04012  ErbB signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    13867 (Erbb3)
   04012 ErbB signaling pathway
    13867 (Erbb3)
   04020 Calcium signaling pathway
    13867 (Erbb3)
   04151 PI3K-Akt signaling pathway
    13867 (Erbb3)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    13867 (Erbb3)
   05205 Proteoglycans in cancer
    13867 (Erbb3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    13867 (Erbb3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    13867 (Erbb3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     13867 (Erbb3)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   13867 (Erbb3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Furin-like Pkinase Kinase-like CD34_antigen APH
Other DBs
NCBI-GeneID: 13867
NCBI-ProteinID: NP_034283
MGI: 95411
Ensembl: ENSMUSG00000018166
UniProt: Q61526
LinkDB
Position
10:complement(128403392..128425504)
AA seq 1339 aa
MSAIGTLQVLGFLLSLARGSEMGNSQAVCPGTLNGLSVTGDADNQYQTLYKLYEKCEVVM
GNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSVLPLPNLRVVRGTQVYDGKFAIFVM
LNYNTNSSHALRQLRFTQLTEILLGGVYIEKNDKLCHMDTIDWRDIVRVPDAEIVVKNNG
GNCPPCHEVCKGRCWGPGPEDCQILTKTICAPQCNGRCFGPNPNQCCHDECAGGCSGPQD
TDCFACRHFNDSGACVPRCPAPLVYNKLTFQLEPNPHIKYQYGGVCVASCPHNFVVDQTF
CVRACPADKMEVDKNGLKMCEPCRGLCPKACEGTGSGSRYQTVDSSNIDGFVNCTKILGN
LDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGG
RSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRVYISANQQLCYHHSLNWTRLLRGPAEE
RLDIKYNRPLGECVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSREGVCVTHCNVLQGEP
REFVHEAHCFSCHPECQPMEGTSTCNGSGSDACARCAHFRDGPHCVNSCPHGILGAKGPI
YKYPDAQNECRPCHENCTQGCKGPELQDCLGQAEVLMSKPHLVIAVTVGLTVIFLILGGS
FLYWRGRRIQNKRAMRRYLERGESIEPLDPSEKANKVLARIFKETELRKLKVLGSGVFGT
VHKGIWIPEGESIKIPVCIKVIEDKSGRQSFQAVTDHMLAVGSLDHAHIVRLLGLCPGSS
LQLVTQYLPLGSLLDHVRQHRETLGPQLLLNWGVQIAKGMYYLEEHSMVHRDLALRNVML
KSPSQVQVADFGVADLLPPDDKQLLHSEAKTPIKWMALESIHFGKYTHQSDVWSYGVTVW
ELMTFGAEPYAGLRLAEIPDLLEKGERLAQPQICTIDVYMVMVKCWMIDENIRPTFKELA
NEFTRMARDPPRYLVIKRASGPGIPPAAEPSALSTKELQDAELEPDLDLDLDVEVEEEGL
ATTLGSALSLPTGTLTRPRGSQSLLSPSSGYMPMNQSNLGEACLDSAVLGGREQFSRPIS
LHPIPRGRQTSESSEGHVTGSEAELQERVSMCRSRSRSRSPRPRGDSAYHSQRHSLLTPV
TPLSPPGLEEEDGNGYVMPDTHLRGTSSSREGTLSSVGLSSVLGTEEEDEDEEYEYMNRK
RRGSPARPPRPGSLEELGYEYMDVGSDLSASLGSTQSCPLHPMAIVPSAGTTPDEDYEYM
NRRRGAGGSGGDYAAMGACPAAEQGYEEMRAFQGPGHQAPHVRYARLKTLRSLEATDSAF
DNPDYWHSRLFPKANAQRI
NT seq 4020 nt   +upstreamnt  +downstreamnt
atgagtgcgattgggactctgcaggtgctgggtttccttctcagcctggcccggggttcc
gagatgggcaactctcaggcagtatgtcctgggactctaaacgggctgagtgtgaccggc
gatgctgacaaccagtaccagacactgtacaaactctatgagaagtgtgaggtggtcatg
ggtaacctggagattgtgcttacgggacacaatgctgatctttccttcctgcaatggatc
cgagaagtgacaggctatgtactggtggccatgaatgaattctctgtactgcccttacct
aacctccgagtggtccggggaacccaggtctacgatgggaagtttgccatctttgtcatg
ttgaactacaataccaactccagccatgctctgcgccagctccggttcactcagcttact
gagattctgttagggggcgtttacattgagaagaatgacaaactttgccacatggataca
attgactggagggacatcgtgagggttccagacgctgagatagtggtgaagaacaacggg
gggaactgtccaccctgtcacgaagtctgcaaggggcgatgctgggggcctggaccagaa
gactgccagatattgaccaagaccatctgtgcccctcagtgtaacggtcgctgcttcggg
cccaatcctaaccagtgctgccacgatgaatgtgcaggtggctgctctggaccccaggac
acagattgcttcgcctgccgacacttcaatgacagtggtgcctgtgtgcccaggtgtcca
gcgccccttgtgtacaacaagctaacgttccagcttgagcccaacccccatatcaagtat
cagtacggaggagtctgtgttgccagttgtccccataactttgtggtggatcagacattt
tgtgtcagggcttgtcctgctgacaagatggaagtagataagaatggactcaagatgtgt
gagccttgcagagggctgtgcccaaaagcctgtgaggggacgggctctggaagccgctac
cagaccgtggactctagcaatatcgatgggttcgtgaactgtaccaagatcctgggcaac
ctggacttcctcatcactggcctcaatggtgacccctggcacaagatccctgcactggac
ccggaaaagctcaatgttttcaggacagtccgggagattacaggctacctaaacatccag
tcctggccccctcacatgcacaacttcagtgttttttccaacctgacgaccatcgggggc
agaagcctctacaatcggggcttctccttgttgatcatgaagaacttgaatgtcacgtct
ctgggcttccggtccctgaaggaaattagtgctgggcgtgtctacataagtgccaatcag
caactttgttaccaccactctctgaactggaccagacttctgcgggggcccgcagaggag
agacttgacatcaagtacaaccggcctctgggagaatgcgtggcagagggcaaagtgtgt
gatccactgtgctcctctgggggatgctggggcccaggccctggtcagtgcttgtcttgt
cgaaactacagccgggaaggtgtctgtgtgactcactgcaacgttctgcaaggggaaccc
cgagagtttgttcatgaggctcattgcttctcctgccatccagaatgccagcccatggag
ggcaccagcacgtgcaatggctcgggctccgacgcttgtgctcgatgcgcccattttcgt
gatgggccccactgtgtgaacagctgcccccatggaatcctaggtgccaaaggtccaatc
tacaaatatccagatgctcagaatgagtgccggccctgccacgagaactgcacccaaggg
tgtaagggaccagaactacaagactgtttaggccaagcagaggtattaatgagcaaacca
cacctggtcatagcggtgacagtaggactgactgtgatcttcctgattctgggaggctct
tttctctattggcgtggacgcaggattcagaataaaagggctatgagacgctacttggag
cggggtgagagcatcgagcctctggacccaagcgagaaggcaaacaaagtcttggctaga
atcttcaaagagacagagctgaggaaacttaaggtgcttggctctggtgtctttggaact
gtacacaaggggatttggattcccgagggtgaatccatcaagattccagtctgcattaaa
gtcatcgaggacaagagtgggcggcagagttttcaggctgtgactgatcacatgctggcc
gtcggcagcctggaccatgcccacattgtacggctgctgggactgtgcccagggtcatct
ctgcagcttgtcactcagtacttgcctctgggctctctccttgatcatgtaagacagcac
cgtgagacactgggaccacagctgctgctcaactggggagtacaaattgccaagggtatg
tattacctcgaggaacacagcatggtgcatagggaccttgcgctccggaatgtgatgctt
aagtcaccgagtcaagtccaggtggcagattttggtgtggctgacttgctgccgccagat
gacaagcagttactacacagtgaggccaagactccaattaaatggatggcccttgagagt
atccactttgggaaatacacacaccagagtgatgtctggagttacggtgtaaccgtttgg
gagttgatgaccttcggggcagagccctacgcagggctacgactggctgaaataccagac
ctgctggagaagggagagcggttagcacagccccagatctgcaccattgacgtctacatg
gtcatggtcaagtgttggatgattgacgagaatattcgcccaacctttaaagaactggcc
aatgagtttaccaggatggcccgggacccaccaaggtatctggtcatcaagagagcgagt
gggcctggaatacctcctgcagcagagccatctgctctgagcaccaaagagttgcaggat
gcagagctggagccagacctggacctcgacctagacgtggaggtagaagaggagggcctg
gcgaccacactgggttctgccctcagcttgcctacaggaacgcttacccggccacgtggg
agccagagtcttttaagtccttcgtctggatacatgcccatgaaccagagcaaccttggg
gaggcttgtctggattctgcggttttggggggtcgcgaacagttctcccgtcccatctct
ctgcacccgatcccacgggggcgtcaaacgtcagagtcatcagagggccatgtgacgggc
tctgaggctgaactccaagagagagtatcaatgtgtaggagccggagccggagccggagc
ccacggccacgtggggacagtgcctaccattcgcagcgacacagcctgcttactcccgtc
accccgctctccccaccagggttagaggaagaggatggcaatggttatgtcatgccagat
acgcacctcagaggtacatcctcttcccgggaaggcaccctttcgtcagtaggtctcagt
tctgtgctgggtaccgaagaggaagatgaagatgaggagtatgaatacatgaaccggaag
aggaggggtagcccggctcggccccccagacctggttccctggaagagctgggctatgag
tacatggatgtgggttcagacctcagtgcttctctgggcagtacgcagagttgcccactc
catcccatggccatcgtgccctctgctggcacgactccagatgaggactatgaatacatg
aaccgcaggcgtggtgcgggcggttccggaggggattatgcagctatgggggcctgccca
gcagctgaacaagggtatgaggaaatgcgagctttccaggggcctggacatcaagccccc
catgttcgttatgcccgcctcaaaactctgcgtagtttagaagccactgactccgccttt
gacaaccccgattactggcatagcaggcttttccctaaggctaacgcccagagaatttga

KEGG   Mus musculus (house mouse): 13869
Entry
13869             CDS       T01002                                 
Symbol
Erbb4, Her4, c-erbB-4
Name
(RefSeq) erb-b2 receptor tyrosine kinase 4
  KO
K05085  receptor tyrosine-protein kinase erbB-4 [EC:2.7.10.1]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04012  ErbB signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu05014  Amyotrophic lateral sclerosis
mmu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    13869 (Erbb4)
   04012 ErbB signaling pathway
    13869 (Erbb4)
   04020 Calcium signaling pathway
    13869 (Erbb4)
   04151 PI3K-Akt signaling pathway
    13869 (Erbb4)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    13869 (Erbb4)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    13869 (Erbb4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    13869 (Erbb4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     13869 (Erbb4)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   13869 (Erbb4)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like Haspin_kinase Kinase-like APH ABC1 DUF3951
Other DBs
NCBI-GeneID: 13869
NCBI-ProteinID: NP_034284
MGI: 104771
Ensembl: ENSMUSG00000062209
UniProt: Q61527
LinkDB
Position
1:complement(68071063..69147756)
AA seq 1292 aa
MKLATGLWVWGSLLMAAGTVQPSASQSVCAGTENKLSSLSDLEQQYRALRKYYENCEVVM
GNLEITSIEHNRDLSFLRSIREVTGYVLVALNQFRYLPLENLRIIRGTKLYEDRYALAIF
LNYRKDGNFGLQELGLKNLTEILNGGVYVDQNKFLCYADTIHWQDIVRNPWPSNMTLVST
NGSSGCGRCHKSCTGRCWGPTENHCQTLTRTVCAEQCDGRCYGPYVSDCCHRECAGGCSG
PKDTDCFACMNFNDSGACVTQCPQTFVYNPTTFQLEHNFNAKYTYGAFCVKKCPHNFVVD
SSSCVRACPSSKMEVEENGIKMCKPCTDICPKACDGIGTGSLMSAQTVDSSNIDKFINCT
KINGNLIFLVTGIHGDPYNAIDAIDPEKLNVFRTVREITGFLNIQSWPPNMTDFSVFSNL
VTIGGRVLYSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYYHTINWTTLFST
INQRIVIRDNRRAENCTAEGMVCNHLCSNDGCWGPGPDQCLSCRRFSRGKICIESCNLYD
GEFREFENGSICVECDSQCEKMEDGLLTCHGPGPDNCTKCSHFKDGPNCVEKCPDGLQGA
NSFIFKYADQDRECHPCHPNCTQGCNGPTSHDCIYYPWTGHSTLPQHARTPLIAAGVIGG
LFILVIMALTFAVYVRRKSIKKKRALRRFLETELVEPLTPSGTAPNQAQLRILKETELKR
VKVLGSGAFGTVYKGIWVPEGETVKIPVAIKILNETTGPKANVEFMDEALIMASMDHPHL
VRLLGVCLSPTIQLVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLV
HRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNADGGKMPIKWMALECIHYRKFTHQ
SDVWSYGVTIWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVKCWMID
ADSRPKFKELAAEFSRMARDPQRYLVIQGDDRMKLPSPNDSKFFQNLLDEEDLEDMMDAE
EYLVPQAFNIPPPIYTSRTRIDSNRNQFVYQDGGFATQQGMPMPYRATTSTIPEAPVAQG
ATAEMFDDSCCNGTLRKPVAPHVQEDSSTQRYSADPTVFAPERNPRGELDEEGYMTPMHD
KPKQEYLNPVEENPFVSRRKNGDLQALDNPEYHSASSGPPKAEDEYVNEPLYLNTFANAL
GSAEYMKNSVLSVPEKAKKAFDNPDYWNHSLPPRSTLQHPDYLQEYSTKYFYKQNGRIRP
IVAENPEYLSEFSLKPGTMLPPPPYRHRNTVV
NT seq 3879 nt   +upstreamnt  +downstreamnt
atgaagctggcgacgggactctgggtctgggggagccttctgatggcagcggggaccgtc
cagcccagcgcttctcagtcagtgtgcgcaggaacagagaacaaactgagctctctctct
gacctggaacagcagtaccgagccttgcgcaaatactatgaaaactgcgaggtagtcatg
ggcaacctggagatcaccagcatcgagcacaaccgggacctctccttcctgcggtctatc
cgagaagtcacaggctacgtcctggtggccctcaaccagtttcgttacttgcctctggag
aatttacgcattattcgtgggacaaaactatatgaagatcgctatgccttagcgatattc
ttaaactacaggaaagatggcaactttggactccaagaacttggattaaagaacctgacc
gaaatactaaatggtggagtctatgtagaccagaacaaattcctatgttatgctgacact
atacactggcaagatattgttcggaatccatggccttccaacatgactctggtgtcaaca
aatggaagttctggatgtggaagatgccataagtcttgcactggccgatgctggggaccc
acagaaaatcactgccagaccttgaccagaactgtgtgtgctgaacaatgtgatggcagg
tgctatggaccctacgttagtgactgctgccatcgagaatgtgctggaggctgctcagga
ccaaaggacactgactgctttgcctgcatgaacttcaatgacagtggagcctgcgttact
caatgtccccaaacatttgtctacaatccaaccacctttcaactggaacacaacttcaat
gcaaagtacacgtatggagcattctgtgttaagaaatgtccacataacttcgtggtagat
tccagttcttgtgtacgagcctgccctagttctaagatggaagtagaagaaaatgggatt
aaaatgtgtaagccttgcaccgatatttgccccaaagcatgtgatggaatcggcacggga
tcactgatgtctgctcagactgtggattcaagtaacattgacaaattcataaactgcaca
aagatcaatggcaatctcatctttcttgtcactggcattcatggagacccttacaatgct
attgacgccatagatccagagaaactgaatgtctttcggactgtcagagaaataacaggt
ttcctgaacatacagtcttggcccccaaatatgacagatttcagtgttttctccaacctc
gtcacaattggaggaagagtcctctacagtggtctctcattgctgatcctcaaacaacaa
ggtatcacttccctacagttccagtctctgaaggaaatcagtgcgggcaatatctacatc
actgacaacagcaacctgtgttattaccataccattaactggacaacactcttcagcacc
attaaccagagaatagtgatccgagataacagaagagctgagaattgtactgctgaaggc
atggtatgcaaccacctgtgttcaaatgatggttgttggggacctgggccggaccagtgc
ctgtcatgtcggcgcttcagcaggggaaagatctgcatagagtcttgcaacctttatgat
ggggaatttcgagagtttgaaaacggctccatctgtgttgagtgtgactcccagtgtgag
aaaatggaagatggactcctcacatgccatggaccgggacctgacaactgcacaaagtgc
tctcattttaaggatggtccaaactgtgtggagaaatgtccagatggcctacagggagca
aacagtttcatttttaagtatgcagatcaggatcgggagtgccacccttgccatccaaac
tgcacccaggggtgtaacggtcccactagtcatgactgcatttactacccatggacgggc
cattccactttaccacaacacgctagaactccactgattgcagccggagtcattggaggc
ctcttcatcctggtgatcatggctttgacatttgctgtctatgtcagaagaaagagcatc
aaaaagaaacgtgctttgaggagattcctggagacagagctggtagagcccttaactccc
agtggcacggcacccaatcaagctcaacttcgcattttgaaggaaaccgaactaaagagg
gtaaaggtccttggctcgggagcttttggaaccgtttataaaggtatttgggtgcctgaa
ggtgaaacagtgaaaatccctgtggctataaagatcctcaatgaaacaactggccccaaa
gccaacgtggagttcatggatgaggctctgatcatggcaagtatggatcacccacaccta
gttcgcctattgggagtgtgtctgagtcccactatccagttggttacgcagctgatgccg
catggctgcctactggactatgttcatgaacacaaggataacattggatcacagctgctg
ttgaactggtgtgtccagattgctaagggaatgatgtacctagaagaaagacggcttgtt
catcgggatctggcagcccgcaatgtcttagtgaaatctccaaatcatgttaaaatcaca
gattttggactggcccggctcttggaaggagatgaaaaagaatacaatgctgatggtggc
aagatgccaattaaatggatggctctggaatgtatacattataggaaattcacacatcaa
agtgatgtttggagctatggcgtcactatatgggaactgatgacctttggaggaaagccc
tatgatggaattccaacccgagaaatccccgatttactggagaaaggagagcgtctgcct
cagcctcccatctgcactattgatgtttacatggtcatggtcaaatgttggatgatcgat
gctgacagcagacctaaattcaaagaactggctgctgagttttcaagaatggctagagac
cctcaaagatacctagttattcagggtgatgatcgtatgaagcttcccagtccaaatgac
agcaaattcttccagaatctcttggatgaagaggatttggaagacatgatggatgctgag
gaatatttggtcccccaggctttcaacatacctcctcccatctacacatccagaacaaga
attgactccaataggaatcagtttgtgtaccaagatgggggctttgctacacaacaagga
atgcccatgccctacagagccacaaccagcaccataccagaggctccagtagctcagggt
gcaacggctgagatgtttgatgactcctgctgtaatggtaccctacgaaagccagtggca
ccccatgtccaagaggacagtagcactcagaggtatagtgctgatcccacagtgttcgcc
ccagaacggaatcctcgaggagaactggatgaagaaggctacatgactccaatgcatgac
aagcccaaacaagaatatctgaatcctgtggaagagaacccttttgtgtcccgaaggaag
aatggagatcttcaagctttagataatccggagtatcacagtgcttccagcggtccaccc
aaggcggaggatgaatacgtgaatgagcctctatacctcaacaccttcgccaatgccttg
gggagtgcagagtacatgaaaaacagtgtactgtctgtgccagagaaagccaagaaagca
tttgacaaccccgactactggaaccacagcctgccaccccggagcacccttcagcaccca
gactacctgcaggaatacagcacaaaatatttttataaacagaatggacggatccgcccc
attgtggcagagaatcctgagtacctctcggagttctcgctgaagcctggcactatgctg
ccccctccgccctacagacaccggaatactgtggtgtga

DBGET integrated database retrieval system