KEGG   Mus musculus (house mouse): 14205
Entry
14205             CDS       T01002                                 
Symbol
Vegfd, AI325264, Figf, VEGF-D
Name
(RefSeq) vascular endothelial growth factor D
  KO
K05449  vascular endothelial growth factor C/D
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04668  TNF signaling pathway
mmu04926  Relaxin signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    14205 (Vegfd)
   04014 Ras signaling pathway
    14205 (Vegfd)
   04015 Rap1 signaling pathway
    14205 (Vegfd)
   04668 TNF signaling pathway
    14205 (Vegfd)
   04020 Calcium signaling pathway
    14205 (Vegfd)
   04151 PI3K-Akt signaling pathway
    14205 (Vegfd)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    14205 (Vegfd)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    14205 (Vegfd)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14205 (Vegfd)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    14205 (Vegfd)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    14205 (Vegfd)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   14205 (Vegfd)
SSDB
Motif
Pfam: PDGF CXCXC
Other DBs
NCBI-GeneID: 14205
NCBI-ProteinID: NP_034346
MGI: 108037
Ensembl: ENSMUSG00000031380
UniProt: P97946
LinkDB
Position
X:163156269..163185646
AA seq 358 aa
MYGEWGMGNILMMFHVYLVQGFRSEHGPVKDFSFERSSRSMLERSEQQIRAASSLEELLQ
IAHSEDWKLWRCRLKLKSLASMDSRSASHRSTRFAATFYDTETLKVIDEEWQRTQCSPRE
TCVEVASELGKTTNTFFKPPCVNVFRCGGCCNEEGVMCMNTSTSYISKQLFEISVPLTSV
PELVPVKIANHTGCKCLPTGPRHPYSIIRRSIQTPEEDECPHSKKLCPIDMLWDNTKCKC
VLQDETPLPGTEDHSYLQEPTLCGPHMTFDEDRCECVCKAPCPGDLIQHPENCSCFECKE
SLESCCQKHKIFHPDTCSCEDRCPFHTRTCASRKPACGKHWRFPKETRAQGLYSQENP
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgtatggagaatggggaatggggaatatcctcatgatgttccatgtgtacttggtgcag
ggcttcaggagcgaacatggaccagtgaaggatttttcttttgagcgatcatcccggtcc
atgttggaacgatctgaacaacagatccgagcagcttctagtttggaggagttgctgcaa
atcgcgcactctgaggactggaagctgtggcgatgccggttgaagctcaaaagtcttgcc
agtatggactcacgctcagcatcccatcgctccaccagatttgcggcaactttctatgac
actgaaacactaaaagttatagatgaagaatggcagaggacccaatgcagccctagagag
acatgcgtagaagtcgccagtgagctggggaagacaaccaacacattcttcaagcccccc
tgtgtaaatgtcttccggtgtggaggctgctgcaacgaagagggtgtgatgtgtatgaac
acaagcacctcctacatctccaaacagctctttgagatatcagtgcctctgacatcagtg
cccgagttagtgcctgttaaaattgccaaccatacgggttgtaagtgcttgcccacgggc
ccccgccatccttactcaattatcagaagatccattcagaccccagaagaagatgaatgt
cctcattccaagaaactctgtcctattgacatgctgtgggataacaccaaatgtaaatgt
gttttgcaagacgagactccactgcctgggacagaagaccactcttacctccaggaaccc
actctctgtggaccgcacatgacgtttgatgaagatcgctgtgagtgcgtctgtaaagca
ccatgtccgggagatctcattcagcacccggaaaactgcagttgctttgagtgcaaagaa
agtctggagagctgctgccaaaagcacaagatttttcacccagacacctgcagctgtgag
gacagatgtccttttcacaccagaacatgtgcaagtagaaagccagcctgtggaaagcac
tggcgctttccaaaggagacaagggcccagggactctacagccaggagaacccttga

KEGG   Mus musculus (house mouse): 22341
Entry
22341             CDS       T01002                                 
Symbol
Vegfc, AW228853, VEGF-C
Name
(RefSeq) vascular endothelial growth factor C
  KO
K05449  vascular endothelial growth factor C/D
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04668  TNF signaling pathway
mmu04926  Relaxin signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    22341 (Vegfc)
   04014 Ras signaling pathway
    22341 (Vegfc)
   04015 Rap1 signaling pathway
    22341 (Vegfc)
   04668 TNF signaling pathway
    22341 (Vegfc)
   04020 Calcium signaling pathway
    22341 (Vegfc)
   04151 PI3K-Akt signaling pathway
    22341 (Vegfc)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    22341 (Vegfc)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    22341 (Vegfc)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    22341 (Vegfc)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    22341 (Vegfc)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    22341 (Vegfc)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   22341 (Vegfc)
SSDB
Motif
Pfam: PDGF CXCXC
Other DBs
NCBI-GeneID: 22341
NCBI-ProteinID: NP_033532
MGI: 109124
Ensembl: ENSMUSG00000031520
UniProt: P97953
LinkDB
Position
8:54530567..54639489
AA seq 415 aa
MHLLCFLSLACSLLAAALIPSPREAPATVAAFESGLGFSEAEPDGGEVKAFEGKDLEEQL
RSVSSVDELMSVLYPDYWKMYKCQLRKGGWQQPTLNTRTGDSVKFAAAHYNTEILKSIDN
EWRKTQCMPREVCIDVGKEFGAATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTGYLSKT
LFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRRSLPATLPQCQAANKTCP
TNYVWNNYMCRCLAQQDFIFYSNVEDDSTNGFHDVCGPNKELDEDTCQCVCKGGLRPSSC
GPHKELDRDSCQCVCKNKLFPNSCGANREFDENTCQCVCKRTCPRNQPLNPGKCACECTE
NTQKCFLKGKKFHHQTCSCYRRPCANRLKHCDPGLSFSEEVCRCVPSYWKRPHLN
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgcacttgctgtgcttcttgtctctggcgtgttccctgctcgccgctgcgctgatcccc
agtccgcgcgaggcgcccgccaccgtcgccgccttcgagtcgggactgggcttctcggaa
gcggagcccgacgggggcgaggtcaaggcttttgaaggcaaagacctggaggagcagttg
cggtctgtgtccagcgtagatgagctgatgtctgtcctgtacccagactactggaaaatg
tacaagtgccagctgcggaaaggcggctggcagcagcccaccctcaataccaggacaggg
gacagtgtaaaatttgctgctgcacattataacacagagatcctgaaaagtattgataat
gagtggagaaagactcaatgcatgccacgtgaggtgtgtatagatgtggggaaggagttt
ggagcagccacaaacaccttctttaaacctccatgtgtgtccgtctacagatgtgggggt
tgctgcaacagcgaggggctgcagtgcatgaacaccagcacaggttacctcagcaagacg
ttgtttgaaattacagtgcctctctcacaaggccccaaaccagtcacaatcagttttgcc
aatcacacttcctgccggtgcatgtctaaactggatgtttacagacaagttcattcaatt
attagacgttctctgccagcaacattaccacagtgtcaggcagctaacaagacatgtcca
acaaactatgtgtggaataactacatgtgccgatgcctggctcagcaggattttatcttt
tattcaaatgttgaagatgactcaaccaatggattccatgatgtctgtggacccaacaag
gagctggatgaagacacctgtcagtgtgtctgcaagggggggcttcggccatctagttgt
ggaccccacaaagaactagatagagactcatgtcagtgtgtctgtaaaaacaaacttttc
cctaattcatgtggagccaacagggaatttgatgagaatacatgtcagtgtgtatgtaaa
agaacgtgtccaagaaatcagcccctgaatcctgggaaatgtgcctgtgaatgtacagaa
aacacacagaagtgcttccttaaagggaagaagttccaccatcaaacatgcagttgttac
agaagaccgtgtgcgaatcgactgaagcattgtgatccaggactgtcctttagtgaagaa
gtatgccgctgtgtcccatcgtattggaaaaggccacatctgaactaa

DBGET integrated database retrieval system